KEGG   Pyrococcus abyssi: PAB1740Help
Entry
PAB1740           CDS       T00024                                 

Definition
Beta-mannosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pab  Pyrococcus abyssi
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PAB1740
  Lipid metabolism
   00600 Sphingolipid metabolism
    PAB1740
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PAB1740
Enzymes [BR:pab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PAB1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(898274..899836)
Genome map
AA seq 520 aa AA seqDB search
MFPENFYWGVSQSGFQFEMGDKYRRHIDPNTDWWHWVRDKVNIEKGLVSGDLPEDGINSY
ELYEVDHNLAKDLGLNMYRIGIEWSRIFPWPTTYVDVDYSIDSSYDLVKDIKIDKSILEE
LDELANQREIAYYRRVISSLRDKGFKVIVNLNHFTLPHWLHDPITAREKALTNSRNGWIN
KRTVIEFAKFAAYIAYKFGDIVDMWSTFNEPMVVVELGYLAPYSGFPPGVMNPEAAKLAM
LNMINAHALAYKMIKKFDKEKADKDSKEAADVGIIYNNIGVAYPENHRNEKDIKAAENDN
FFHSRLFLEAITWGKLNIEFDGETFVNLPYLKGNDWIGINYYTREVVKWSDPMFPTLPLI
TFKGVPGYGYACRPGMSSKSGNPVSDMGWEIYPEGIYNSIVEAERYGVPLYITENGIADS
KDVLRPYYIVSHLAVIEEAYEEGHEVRGYLHWALTDNYEWPLGFRMRFGLYEVNLITKER
KPRKRSVEVFSRIISEGTTKGLQDEFRLKVRGERYENDSG
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttcccagagaacttttactggggtgtctcacagtcaggatttcagtttgagatgggg
gataaatataggaggcatatagatccaaacactgactggtggcactgggttagggacaaa
gtgaacattgaaaagggcctcgttagtggagatctacctgaagacggcatcaacagttat
gaactttatgaagtagatcataatctggcgaaggatttaggtctcaacatgtatcgtata
ggaattgagtggagtagaatatttccctggccgacgacttatgttgatgttgattattct
atcgatagctcatatgacctagtaaaagatatcaaaatagacaagagcattctagaggag
cttgatgagcttgcaaatcaaagggagattgcttactataggagagtcatctcaagctta
agagataagggattcaaggttatcgttaatcttaatcactttacattgccacattggctc
catgatccaataaccgcaagagaaaaagcgctaacgaacagtagaaatggttggataaac
aagagaacggtaattgagtttgctaaatttgcagcttatattgcgtacaaatttggcgat
atcgttgacatgtggagcacttttaacgaacctatggttgtagttgagctaggttaccta
gccccatactccggattccccccaggagtcatgaatcccgaagctgcaaagttggctatg
ctcaacatgataaatgcgcatgcccttgcgtataagatgataaagaaatttgacaaagaa
aaagctgacaaagattcaaaagaggctgctgatgttggaataatttacaacaacataggg
gttgcctatccagagaatcacagaaatgaaaaggatatcaaggcagccgagaatgacaac
ttcttccacagcagattattcttggaggccataacatgggggaaactcaacattgagttt
gacggtgaaacatttgtcaacttgccttacctaaaaggtaatgattggattggaattaac
tactatactagagaagttgttaaatggagtgatcccatgtttccaacactgccattgata
actttcaaaggagttccgggatatggttacgcttgtaggccgggaatgtcatcaaaatcg
ggaaatccagttagtgatatgggctgggagatataccctgagggaatatataactcgatt
gttgaggcggaaagatatggggtacctctgtatataacggagaatggaatcgccgactca
aaggatgttctaaggccctactatattgtaagccacttagccgtgatagaggaagcttat
gaagagggccatgaagtgaggggttatctccattgggccctaactgataactatgagtgg
ccattaggatttagaatgcgctttggtctctacgaagtaaacttaataacaaaggaaaga
aaacctaggaagaggagtgttgaagtttttagtaggataatttcagaggggacgacaaaa
ggcctacaagacgagttcagactcaaagttaggggggagagatatgaaaacgatagcggt
tga

DBGET integrated database retrieval system