KEGG   Pyrococcus abyssi: PAB1869Help
Entry
PAB1869           CDS       T00024                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pab  Pyrococcus abyssi
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAB1869
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAB1869
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PAB1869
Enzymes [BR:pab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PAB1869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(701639..702958)
Genome map
AA seq 439 aa AA seqDB search
MKCPKCGREYKAEIPPFCICGEELEITYDYSSVDTRKWKNRRPGVWRYKELLPKVKKIVS
LQEGGTPLIKARISEQLNVDVFIKDETRNPTGSFRDRLATVAISYGLPYAKNGFIVASDG
NAAASVAAYSARAEKECFVVIPRKVDKGKLIQMIAFGARIIRYGESVDDAIEYAKELAKL
NGLYNVTPEENIVGLEGQKTIAFELWEEINPTHVIVPTGSGSYLYSIYKGFKELIEIGAL
EEMPKLIAVQTDRCNPIASEILGIKGECKETKALGLYVREPLMKPKVIRAIRESSGTAVL
VSEEEIEKGERLLANEGIFAELSSAVVMPALIKLVNDGFIEKGDRVVLVVTGSGLKTGEG
GREKFGIGGTKLEILKILKDGEKYAYEIWQALGKPVKYQAIHQHIKELQELGLIEEAYRR
GKRIYYKLTEKGIRLVDNL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgccctaaatgtgggcgagagtacaaagcagaaattccaccattctgtatttgt
ggtgaggagttagaaataacttacgactactcctctgttgatacgaggaaatggaagaat
agacggcctggagtgtggcgatataaggagttattgcctaaggtaaagaagatagtaagt
ttgcaagaaggtggaaccccactaataaaggcaagaataagcgagcaacttaacgtagat
gtttttattaaagacgagaccagaaacccaacgggatcttttagggacagacttgcaacg
gttgcaatttcatatggtttaccttatgcaaagaacggtttcatagtggcaagcgacggg
aatgctgctgcttcggtagcagcgtattctgctagggccgagaaggaatgcttcgttgtc
attccaaggaaggtagataagggaaagctaattcaaatgatagcctttggggcgaggata
ataaggtacggtgaaagcgttgatgatgctatagaatacgctaaagagcttgcaaagcta
aacggattatacaatgtaactcctgaagagaatatagtagggctagagggccaaaagacc
atagcatttgagctttgggaagaaattaacccaacccatgttatagtgccaactggaagt
ggaagttacctttactccatctacaaaggatttaaggagttaattgagattggagccctt
gaagagatgcccaagctaatagcagttcaaacagatagatgcaatccaatagcttccgaa
atattaggaattaaaggtgagtgcaaggaaactaaagctcttggtctttacgtaagggaa
cctcttatgaaacccaaagttatcagggccataagggaaagcagtggaacggctgttcta
gttagtgaagaagagatagagaaaggcgagaggttacttgcgaatgaaggaatttttgcc
gaattatcgtcggcggtagtcatgccagccttaattaagctcgtaaatgacggattcatt
gagaaaggggatagggtagttctagttgtaactggttctggattaaagacaggagaagga
ggaagagagaaatttgggattggcggaactaagcttgaaattttgaagatactcaaggat
ggagaaaaatatgcctatgagatatggcaagccttaggaaaacccgttaagtatcaagcc
attcaccagcacataaaagagcttcaagagctaggactaattgaagaggcatatagaagg
ggaaagagaatttattataagcttactgaaaaagggattaggttagttgacaacctttaa

DBGET integrated database retrieval system