KEGG   Pyrococcus abyssi: PAB1869Help
Entry
PAB1869           CDS       T00024                                 

Definition
(GenBank) Pyridoxal phosphate dependent enzyme
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pab  Pyrococcus abyssi
Pathway
pab00260  Glycine, serine and threonine metabolism
pab00750  Vitamin B6 metabolism
pab01100  Metabolic pathways
pab01110  Biosynthesis of secondary metabolites
pab01120  Microbial metabolism in diverse environments
pab01230  Biosynthesis of amino acids
Module
pab_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAB1869
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PAB1869
Enzymes [BR:pab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PAB1869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP HTH_45 PadR HTH_5 ACP_syn_III_C DUF4364 HTH_27 HxlR SMC_ScpB DUF1495 DUF2250 HTH_20
Motif
Other DBs
NCBI-ProteinID: CAB49662
UniProt: Q9V0P1
Position
complement(701639..702958)
Genome map
AA seq 439 aa AA seqDB search
MKCPKCGREYKAEIPPFCICGEELEITYDYSSVDTRKWKNRRPGVWRYKELLPKVKKIVS
LQEGGTPLIKARISEQLNVDVFIKDETRNPTGSFRDRLATVAISYGLPYAKNGFIVASDG
NAAASVAAYSARAEKECFVVIPRKVDKGKLIQMIAFGARIIRYGESVDDAIEYAKELAKL
NGLYNVTPEENIVGLEGQKTIAFELWEEINPTHVIVPTGSGSYLYSIYKGFKELIEIGAL
EEMPKLIAVQTDRCNPIASEILGIKGECKETKALGLYVREPLMKPKVIRAIRESSGTAVL
VSEEEIEKGERLLANEGIFAELSSAVVMPALIKLVNDGFIEKGDRVVLVVTGSGLKTGEG
GREKFGIGGTKLEILKILKDGEKYAYEIWQALGKPVKYQAIHQHIKELQELGLIEEAYRR
GKRIYYKLTEKGIRLVDNL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgccctaaatgtgggcgagagtacaaagcagaaattccaccattctgtatttgt
ggtgaggagttagaaataacttacgactactcctctgttgatacgaggaaatggaagaat
agacggcctggagtgtggcgatataaggagttattgcctaaggtaaagaagatagtaagt
ttgcaagaaggtggaaccccactaataaaggcaagaataagcgagcaacttaacgtagat
gtttttattaaagacgagaccagaaacccaacgggatcttttagggacagacttgcaacg
gttgcaatttcatatggtttaccttatgcaaagaacggtttcatagtggcaagcgacggg
aatgctgctgcttcggtagcagcgtattctgctagggccgagaaggaatgcttcgttgtc
attccaaggaaggtagataagggaaagctaattcaaatgatagcctttggggcgaggata
ataaggtacggtgaaagcgttgatgatgctatagaatacgctaaagagcttgcaaagcta
aacggattatacaatgtaactcctgaagagaatatagtagggctagagggccaaaagacc
atagcatttgagctttgggaagaaattaacccaacccatgttatagtgccaactggaagt
ggaagttacctttactccatctacaaaggatttaaggagttaattgagattggagccctt
gaagagatgcccaagctaatagcagttcaaacagatagatgcaatccaatagcttccgaa
atattaggaattaaaggtgagtgcaaggaaactaaagctcttggtctttacgtaagggaa
cctcttatgaaacccaaagttatcagggccataagggaaagcagtggaacggctgttcta
gttagtgaagaagagatagagaaaggcgagaggttacttgcgaatgaaggaatttttgcc
gaattatcgtcggcggtagtcatgccagccttaattaagctcgtaaatgacggattcatt
gagaaaggggatagggtagttctagttgtaactggttctggattaaagacaggagaagga
ggaagagagaaatttgggattggcggaactaagcttgaaattttgaagatactcaaggat
ggagaaaaatatgcctatgagatatggcaagccttaggaaaacccgttaagtatcaagcc
attcaccagcacataaaagagcttcaagagctaggactaattgaagaggcatatagaagg
ggaaagagaatttattataagcttactgaaaaagggattaggttagttgacaacctttaa

DBGET integrated database retrieval system