KEGG   Pyrococcus abyssi: PAB1937Help
Entry
PAB1937           CDS       T00024                                 

Definition
hypothetical protein
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
pab  Pyrococcus abyssi
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAB1937
   00620 Pyruvate metabolism
    PAB1937
   00640 Propanoate metabolism
    PAB1937
Enzymes [BR:pab01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     PAB1937
Lipid biosynthesis proteins [BR:pab01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PAB1937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(606146..607528)
Genome map
AA seq 460 aa AA seqDB search
MSLEALFNPKSIAVIGASSKPGKIGYAIMKNLIEYGYEGKIYPVNIKGGEMEISGRKFKV
YKSILEVPDEVDMAIIVVPAKFVPQVVEECGQKGVKVVPIISSGFGELGEEGKKVEQQLV
ETARKYGMRILGPNIFGVVYTPAKLNGTFGPTDVLPGPLALISQSGALGIALMGWTILEK
IGLSAVVSVGNKADIDDADLLEFFKDDENTRAILIYMEGVKDGRRFMEVAKEVSKKKPII
VIKAGRSERGAKAAASHTGSLAGSDTIYSAAFKQSGVLRALTIGEAFDWARALSNLPEPQ
GDNVVIITNGGGIGVMATDAAEEEGLKLYDDLEQLKIFANHMPPFGSYKNPVDLTGMADA
KSYEGAIRDALNHPEMHSIIVLYCQTAVLDPRDLAEIIIREYNESGRKKPLVVAIVGGIE
AKEAIDTLNENGIPAYPEPERAVKALSALYRWSKWKAKHK
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgagcttagaggctctttttaaccccaagagtatcgctgttataggagcttcttcaaag
ccaggaaagataggatatgctattatgaagaacctgatcgagtatggctacgaaggcaag
atttaccccgtgaacattaaaggtggggaaatggaaataagtggaaggaagttcaaggtt
tacaagagcatccttgaagttccagatgaagttgacatggcaattatagtcgtcccagct
aagttcgttcctcaggtagttgaggaatgcggtcagaagggagtcaaggtagttccaata
atatcttcggggtttggagagcttggagaggaaggaaagaaagttgagcaacaactcgtc
gaaaccgcaaggaagtacggaatgagaatcctaggaccgaacatcttcggagttgtttat
acaccagctaaattgaatggaacttttggcccaacagacgttcttcctgggcccttggca
ttgataagccagagtggagcactaggaattgccctaatgggatggactatacttgagaag
attggcctctcggcagtagtgagcgttgggaacaaggctgacatcgatgatgccgatcta
ctggaattcttcaaggacgacgagaatactagggcgatactgatttacatggagggcgtt
aaggatggaagaaggttcatggaagttgcaaaggaggttagcaagaagaagccgataata
gttataaaggctggaagaagtgagaggggagcaaaggccgcagcttctcacacgggttca
ctagcgggaagcgataccatttatagcgcagcgttcaagcagagcggagtgcttagggcg
ctcactataggagaggcttttgactgggccagagcattgagcaacttgccagaaccccag
ggagataacgtcgttataataaccaacggtggtggtatcggagttatggccacagatgcc
gctgaagaagaagggttgaagctttacgacgacttggagcaactgaagatattcgccaat
cacatgcctccattcggaagctacaagaacccggtggacttaactggaatggccgatgca
aagagctacgaaggagcaattagggatgcgcttaaccacccagagatgcactcaataata
gtcctgtactgccaaaccgcagttctcgacccaagagatttggcagaaattataattagg
gagtacaacgagagcggaaggaagaagccattggtcgttgcaatcgttggtggaattgag
gcgaaggaagctattgacaccctaaacgagaacggaattccagcatatccagagcctgaa
agggcagtaaaagcattatcagctctatacagatggagcaagtggaaagctaagcacaag
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system