KEGG   Pyrococcus abyssi: PAB1937Help
Entry
PAB1937           CDS       T00024                                 

Definition
(GenBank) acdA-2 acetate--coA ligase (ADP-forming) (EC 6.2.1.13), alpha chain
  KO
K01905  acetate---CoA ligase (ADP-forming) subunit alpha [EC:6.2.1.13]
Organism
pab  Pyrococcus abyssi
Pathway
pab00010  Glycolysis / Gluconeogenesis
pab00620  Pyruvate metabolism
pab00640  Propanoate metabolism
pab01100  Metabolic pathways
pab01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAB1937
   00620 Pyruvate metabolism
    PAB1937
   00640 Propanoate metabolism
    PAB1937
Enzymes [BR:pab01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     PAB1937
Lipid biosynthesis proteins [BR:pab01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PAB1937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Succ_CoA_lig CoA_binding_2 CoA_binding NAD_Gly3P_dh_N Ligase_CoA DUF4849
Motif
Other DBs
NCBI-ProteinID: CAB49565
UniProt: Q9V0Y7
Position
complement(606146..607528)
Genome map
AA seq 460 aa AA seqDB search
MSLEALFNPKSIAVIGASSKPGKIGYAIMKNLIEYGYEGKIYPVNIKGGEMEISGRKFKV
YKSILEVPDEVDMAIIVVPAKFVPQVVEECGQKGVKVVPIISSGFGELGEEGKKVEQQLV
ETARKYGMRILGPNIFGVVYTPAKLNGTFGPTDVLPGPLALISQSGALGIALMGWTILEK
IGLSAVVSVGNKADIDDADLLEFFKDDENTRAILIYMEGVKDGRRFMEVAKEVSKKKPII
VIKAGRSERGAKAAASHTGSLAGSDTIYSAAFKQSGVLRALTIGEAFDWARALSNLPEPQ
GDNVVIITNGGGIGVMATDAAEEEGLKLYDDLEQLKIFANHMPPFGSYKNPVDLTGMADA
KSYEGAIRDALNHPEMHSIIVLYCQTAVLDPRDLAEIIIREYNESGRKKPLVVAIVGGIE
AKEAIDTLNENGIPAYPEPERAVKALSALYRWSKWKAKHK
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgagcttagaggctctttttaaccccaagagtatcgctgttataggagcttcttcaaag
ccaggaaagataggatatgctattatgaagaacctgatcgagtatggctacgaaggcaag
atttaccccgtgaacattaaaggtggggaaatggaaataagtggaaggaagttcaaggtt
tacaagagcatccttgaagttccagatgaagttgacatggcaattatagtcgtcccagct
aagttcgttcctcaggtagttgaggaatgcggtcagaagggagtcaaggtagttccaata
atatcttcggggtttggagagcttggagaggaaggaaagaaagttgagcaacaactcgtc
gaaaccgcaaggaagtacggaatgagaatcctaggaccgaacatcttcggagttgtttat
acaccagctaaattgaatggaacttttggcccaacagacgttcttcctgggcccttggca
ttgataagccagagtggagcactaggaattgccctaatgggatggactatacttgagaag
attggcctctcggcagtagtgagcgttgggaacaaggctgacatcgatgatgccgatcta
ctggaattcttcaaggacgacgagaatactagggcgatactgatttacatggagggcgtt
aaggatggaagaaggttcatggaagttgcaaaggaggttagcaagaagaagccgataata
gttataaaggctggaagaagtgagaggggagcaaaggccgcagcttctcacacgggttca
ctagcgggaagcgataccatttatagcgcagcgttcaagcagagcggagtgcttagggcg
ctcactataggagaggcttttgactgggccagagcattgagcaacttgccagaaccccag
ggagataacgtcgttataataaccaacggtggtggtatcggagttatggccacagatgcc
gctgaagaagaagggttgaagctttacgacgacttggagcaactgaagatattcgccaat
cacatgcctccattcggaagctacaagaacccggtggacttaactggaatggccgatgca
aagagctacgaaggagcaattagggatgcgcttaaccacccagagatgcactcaataata
gtcctgtactgccaaaccgcagttctcgacccaagagatttggcagaaattataattagg
gagtacaacgagagcggaaggaagaagccattggtcgttgcaatcgttggtggaattgag
gcgaaggaagctattgacaccctaaacgagaacggaattccagcatatccagagcctgaa
agggcagtaaaagcattatcagctctatacagatggagcaagtggaaagctaagcacaag
tga

DBGET integrated database retrieval system