KEGG   Pyrococcus abyssi: PAB1982Help
Entry
PAB1982           CDS       T00024                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pab  Pyrococcus abyssi
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pab00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(537552..539075)
Genome map
AA seq 507 aa AA seqDB search
MVFVMRAKVRILNIRSGHFDVFINPKDAQEWKLHPNDLVKIESGKRSIYGSVVIGDFVES
GEVGLSLDILDAYQFSEGELVSITPSETPESVRYIKKKMRGEKLRKVEIETIVRDIVDRK
LRNTEISALVTAIEVNGLDMDEIAALTIAMAETGDMLDIDRKPIMDVHSIGGVPGNKTNI
IVVPIVAAAGLTIPKTSSRAITSAAGTADVVEVFTNVTLSLDEIKRIVEKIGACLVWGGA
LNLAPADDLTIHVERRLSLDPRGLMLASIMSKKYAIGSQYILIDIPTGKGAKVETMEEAR
SLAKDFIELGKKLGQYVEVAITYGGQPIGYTVGPALEAKEALETLMTGKGPGSLVEKALG
LAGILLEMGGVAPRGMGKKVAREILESGKAYEKIKEIIEEQGGDPNIKPEDIPIGDKTYT
IHAQTSGYVTGIDNKAITAIAREAGAPEDKGAGVKLHVKVGEKVKEGDPLFTIHAESESR
LDKAIILARRLEPIKIEGMVLQVLGNL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtggtgttcgttatgagagccaaggttaggattttgaacataaggagtggacacttcgac
gttttcataaaccctaaagatgcccaggaatggaagcttcacccaaacgacctagtaaag
attgaaagtggaaaaagatcaatctacggtagcgtcgttataggggacttcgtcgagagt
ggagaagtcgggctgtcgttagatattctagatgcgtatcagttctcggagggagaacta
gtttccataaccccaagtgaaactccagagagcgttagatacataaaaaagaagatgaga
ggagagaagctcaggaaagttgaaattgaaaccatagttagggacatcgttgataggaag
ctcagaaatacagagataagcgcattggtaactgcaatagaagttaatggcctcgatatg
gacgagatagcggccttaacaattgcaatggccgaaacgggggatatgcttgatatagac
agaaagccgataatggacgttcacagcattggaggagttcctgggaataagacgaacata
atagtggttcccatagttgccgccgctggattaactataccaaaaacgagctcgagggcc
ataacgagtgccgcaggaacagcagatgttgttgaggtttttacgaacgtcaccttaagc
cttgatgagattaagaggatagtcgaaaagataggagcttgtctagtgtggggaggagcc
cttaatttggcccctgcagacgatttaacaattcacgtcgagaggagacttagcttagac
ccaagggggctaatgctcgcgagtataatgtcaaagaaatacgccatcgggagtcagtat
atattaatcgacatcccaactggaaaaggtgcgaaggttgagaccatggaggaggccaga
tccctagcgaaggattttatagagctgggaaagaaattaggtcaatacgttgaagttgca
ataacctatgggggccagcctataggctacacggtcggacctgcccttgaggccaaagaa
gctctagaaacgctaatgacaggaaaaggcccgggaagcttagttgaaaaagccctaggc
cttgccggtatcttgctcgagatgggaggagttgcaccaaggggaatgggaaagaaagtt
gctagggagattcttgagagcggaaaggcctatgaaaagatcaaggagataatagaagag
cagggaggagatccaaacataaagccagaagacattccaattggagataaaacgtacaca
atccacgctcaaacaagtgggtacgttacaggtatagacaacaaggcgataactgcaata
gctagggaggcaggtgccccagaagacaaaggcgctggagttaaattacatgttaaagtt
ggagaaaaggtcaaggaaggggatccactatttactatacatgcagaaagcgagagtagg
ctagataaagccataatccttgccaggaggttagagccaataaagatagaaggaatggtg
cttcaagtactcggaaacctctaa

DBGET integrated database retrieval system