KEGG   Pyrococcus abyssi: PAB2043Help
Entry
PAB2043           CDS       T00024                                 

Definition
(GenBank) trpC indole-3-glycerol phosphate synthase (EC 4.1.1.48) (IGPS)
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pab  Pyrococcus abyssi
Pathway
pab00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pab01100  Metabolic pathways
pab01110  Biosynthesis of secondary metabolites
pab01130  Biosynthesis of antibiotics
pab01230  Biosynthesis of amino acids
Module
pab_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAB2043
Enzymes [BR:pab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PAB2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS G3P_antiterm
Motif
Other DBs
NCBI-ProteinID: CAB49386
UniProt: Q9V1G3
Position
complement(446586..447275)
Genome map
AA seq 229 aa AA seqDB search
MVIFGLSRRIKRCTKNPIIAELKVYSPKYGDLLRGRDPLEILRRYERAGAVGISYITDPK
YFRGNFDFFKRLCKETELPVLRKDFITTKEEIEKTAEAGGSAVLLITRLLKDKLPEFVDH
AREHGLDTLVEVHTLEELKIAIQTNSTMIGINNRDIGKLELDDGNVSLTAKLAPLIPDKF
VKVSESGITTLEDLKVALKYADAALIGTALMKTEDPEKLLKSFVEAKIC
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatttttggactgagcaggagaataaagaggtgcactaagaatccgataatagct
gagcttaaggtctattctccgaagtatggggatctcctaagaggtagggatccccttgag
attctcaggagatacgagagagcaggggctgtcggaatatcttatataacagaccccaaa
tatttcaggggaaacttcgatttcttcaaaaggctctgcaaggaaactgagctaccagtt
cttaggaaagactttatcactaccaaagaggaaatagagaaaacagccgaagctggagga
tcggctgttctactcataacgagactcttaaaggataagctcccagaattcgttgatcat
gcaagggaacatggactcgataccctagtcgaagttcacactttagaagaactaaaaata
gcgattcaaactaattctaccatgattgggataaataacagggatataggaaagcttgag
ctagacgacggaaacgtatcattaacagccaagctagcccccctaatcccagataaattt
gtaaaggtcagcgaaagtgggataacaaccttagaagatttgaaagtagcactgaaatat
gcagatgcggcccttattgggacagcccttatgaaaactgaagatcctgaaaaacttctg
aaaagttttgtggaggctaaaatatgctag

DBGET integrated database retrieval system