KEGG   Pyrococcus abyssi: PAB2048Help
Entry
PAB2048           CDS       T00024                                 

Definition
(GenBank) trpB tryptophan synthase, subunit beta (EC 4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pab  Pyrococcus abyssi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAB2048
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAB2048
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAB2048
Enzymes [BR:pab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PAB2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(441984..443150)
Genome map
AA seq 388 aa AA seqDB search
MWFGKFGGQYVPETLMEPLRELEKAYKRLKNDEEFNRQLDYYLRTWAGRPTPLYYAERLT
KKVGGAKIYLKREDLLHGGAHKTNNAIGQALLAKFMGKTRLIAETGAGQHGVATAMAGAL
LGMKVDIYMGAEDVERQKMNVFRMKLLGANVIPVHTGSKTLKDAINEALRDWVATFEYSH
YLIGSVVGPHPYPIIVRDFQSVIGREAREQILEAEGDLPDVIVACVGGGSNAMGIFYPFV
KDKSVRLIGVEAGGKGIESGKHSASLNAGEIGVFHGMLSYFLQDEEGQIRTTHSIAPGLD
YPGVGPEHAYLKESGRAEYVTVTDEEALRAFHELSRTEGIIPALESAHAVAYAIKLAREM
SRDDVIIVNLSGRGDKDLDIVLKVSGNV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcggtaaatttggaggtcaatacgttcctgaaacccttatggaaccgttgaga
gagcttgagaaggcttataagaggttaaagaatgacgaagaatttaacaggcaactcgat
tattacctaagaacctgggctggaagaccaactccactctactacgcagagagattaacc
aagaaagttggaggggcaaagatatacctaaagagagaagatctcctacatggaggagct
cacaagacgaataacgcaataggccaagcattacttgctaagttcatggggaaaacccgg
ttaatcgcagaaaccggagctgggcaacatggagttgcaacagcaatggctggagcattg
cttggaatgaaagttgacatatacatgggtgctgaggacgttgagaggcagaagatgaac
gttttcaggatgaaactcctgggagcaaacgtcattccagtccatacgggttctaaaacc
ctaaaggatgcaatcaacgaggctctcagagattgggtagcaaccttcgagtattcccac
tacctcataggctcggtagttggtccccatccatatccgataatagtgagggacttccag
tctgtgataggaagggaagctagggagcagatacttgaagcggaaggggatttaccagat
gtaatagttgcttgcgttggtggtgggagtaacgcgatgggtatattctatccattcgtc
aaagacaaaagcgttaggctcataggcgttgaggctgggggaaagggtatcgagagcggg
aaacactcggcatccctaaacgcaggagagattggagttttccatggaatgctcagttac
ttccttcaggatgaagagggacagataagaacaacccacagcatagcccccggattagat
tatccaggggtagggcccgagcatgcgtatctaaaggagagcggaagagctgaatacgtt
accgttacagacgaggaagctctaagagcgttccacgagttgtctaggacagaaggaatt
attccagccttggaatcagcacatgccgttgcctacgcaattaagttagccagggagatg
agtagggatgacgtgataatagtgaacctctcaggaaggggagacaaagatttagatata
gtgctcaaggtgagcgggaatgtttag

DBGET integrated database retrieval system