KEGG   Pyrococcus abyssi: PAB2085Help
Entry
PAB2085           CDS       T00024                                 

Gene name
aor-1
Definition
tungsten-containing aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pab  Pyrococcus abyssi
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pab01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pab00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(386096..387982)
Genome map
AA seq 628 aa AA seqDB search
MYGYAGKILRVDLSKRSYEVTGLDKKVAKMFIGGRGFNIARLYWEVPPEISPLSEHNKLM
LSTGPLAGTGFPLGSRLNVSARSPQTGLLGDSNVGGHFGAEMKYAGFDQIIIEGKSDKPV
YLYITESGVEFMDAEGLWGLRVSEAHREILRELGDWRVQTAIIGPAAENFVKFAGIFFNV
HRPAARTGMGTVMASKNLKAIAVRGDGFVEVAKPEEFEKLVEEIELETYAHEEYWSRRIM
GTSRILLAANRIGVLPGRHFTEPEVDYAYLVSGERLALEYNVKTRGCFSCVVPCSRVFLI
KRGKYAGIMGEGPEYEALAGMTVRIGNSDLDAALYAVKLINDLGLDVISTSEVISWLMEL
YERGDITSDEIGGLKPVWGDMETVLTLIEDIAYRRGVGDVLADGVLKAAEKLGKGKDIAM
QVKGLEMIQADPRGLKGYGLGFAVSTRGADHLRSEPFVELTDNPELCRKLLGIPEACKRL
GVRGKGVLVAHYENLCAVVDAIEVCKNLAENMNILDYEKVARLIHVTTGMKMTARDVELV
GERIINMERAYIARLGVRREHDRLPERFLRKPLPKGASKGHVIELEPMLEEYYRIRKWDP
GKGIPTEKRLKELGLEDVATDLKERGVF
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
gtgtacggctatgccgggaagattctcagggttgacctgtcaaaacggagttacgaggtc
acagggctcgacaaaaaggttgccaagatgttcataggcggcaggggctttaacatcgcc
aggctttactgggaagtgcccccagagatatccccgttaagcgagcacaacaagctgatg
ttatcaacgggacccctcgctggtacgggttttcccctcggctcacgccttaacgtgtcc
gcgaggtcgccacagacgggccttttgggcgactccaacgttggagggcactttggagct
gaaatgaagtacgcgggatttgaccagataataatagaaggcaagagcgacaagccggtt
tacctgtacataacggagagtggagttgaattcatggacgccgagggcttgtgggggtta
agagtttcagaggcacacagggagatactccgtgaactcggggactggagggtacagacg
gctataataggtcccgccgctgagaacttcgttaagttcgcggggatatttttcaacgtc
cacagaccagcagcaagaaccggcatggggacggtgatggcatcaaagaatctcaaagcg
atagccgtcaggggggacggtttcgtcgaggtggcaaagccggaagagttcgaaaagctg
gtcgaggaaatcgagcttgaaacgtatgcccacgaggagtactggtcgcgcagaattatg
ggcacgtcaaggatactcctggcggcgaacagaattggagtactcccaggaaggcacttc
accgagccggaagtagactatgcgtacctggttagcggagagaggcttgccctcgagtat
aacgtgaagacgagggggtgcttttcttgtgtggttccctgcagcagggtgttcctcata
aagagggggaagtacgcaggcattatgggagagggccccgaatatgaagccctagctggg
atgacggttaggattgggaatagtgacctcgacgcggccctttatgccgtaaaactaatt
aatgacctcggactcgacgtgattagcacgagtgaagtgatttcatggctaatggagctc
tacgaaaggggagatattacgagcgacgagataggcgggctaaagccggtgtggggagat
atggaaacggttctcactctcatagaagatatagcgtacagaaggggcgttggtgatgtt
ctcgctgacggggtcctgaaggcagctgaaaagcttggcaaaggcaaagatatcgccatg
caggtcaagggactggaaatgatacaggccgacccgaggggcctgaaaggctacgggctg
gggtttgcagtctcgacgaggggcgcagaccatctccgttcggagccgttcgtcgagctc
actgataaccctgagctgtgtaggaaactcctcggtatccccgaggcatgtaagaggctc
ggtgtcaggggcaagggagtactcgtagcccactatgagaacctgtgcgcggtagtagat
gccatagaggtctgtaagaatcttgccgagaatatgaacatactggactatgaaaaggta
gcaagacttattcacgtcacaactggaatgaaaatgactgcccgagacgttgagctcgta
ggcgagaggatcatcaacatggagagggcatacatagcccggctcggggtgaggagggag
catgacagacttccagaacgctttctcaggaagccactacccaaaggagcgtcaaaggga
catgtcatagagcttgagccaatgcttgaggaatactataggatcagaaagtgggatcct
gggaaagggatacctactgagaaacggctgaaggaactgggtcttgaggatgtggccacg
gacttgaaagagcgaggagtattttaa

DBGET integrated database retrieval system