KEGG   Pyrococcus abyssi: PAB2096Help
Entry
PAB2096           CDS       T00024                                 

Definition
(GenBank) Aminopeptidase from family M42
  KO
K20608  
tetrahedral aminopeptidase [EC:3.4.11.-]
Organism
pab  Pyrococcus abyssi
Brite
Enzymes [BR:pab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     PAB2096
Peptidases [BR:pab01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   PAB2096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(367846..368886)
Genome map
AA seq 346 aa AA seqDB search
MVDWKLMQEIIEAPGVSGYEFLGIRDLVVDLLKEVADEVKVDKLGNVIAHFKGSSPRVMV
SAHMDKIGVMVNHIDNNGYLHIVPIGGVLPETLVAQRIRFFTEKGERYGVVGVLPPHLRR
GQQDKGGKIDWDQIVVDVGASNKEEAEEMGFKVGTVGEFAPNFTRLSEHRFATPYLDDRI
CLYAMIEAARQLGEHEADVYIVASVQEEVGLRGARVASYAIDPEIGIAMDVTFAKQPHDK
GKIVPELGKGPVMDVGPNINPKLRAFADEVAKKYEIPLQVEPSPRPTGTDANVMQINREG
VATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDLTP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggttgactggaaattgatgcaggaaataattgaggccccaggagtttcaggatacgaa
ttcctgggaattagggacttggttgttgatttactaaaagaggtcgccgacgaagttaag
gtagacaaactcgggaacgtgatagctcactttaagggctcatctccaagggttatggtt
tcagctcacatggacaaaatcggagtcatggtcaaccacatcgacaacaacggctacctc
cacatagttcccataggcggagtcctcccagaaactttagtggcacagaggataaggttc
ttcacagaaaaaggtgaaaggtacggagtcgttggagttctcccaccgcacctcaggaga
ggccaacaagacaagggaggaaagatagattgggaccagatagtggtcgatgtaggcgca
tcaaacaaggaagaagccgaagagatgggattcaaggtcggaaccgttggagagttcgct
ccaaacttcacgagacttagcgaacacaggttcgcaaccccctaccttgacgacagaatc
tgtttatacgcaatgatagaggccgctaggcaactcggggagcatgaggcagatgtttac
atagttgcatcagttcaggaggaagtagggcttagaggtgccagggttgcgagctatgct
atagacccagagataggaatagcgatggatgtaacatttgcaaagcaaccccacgataag
ggtaagatagttccagagctcggaaaaggcccagttatggacgtcgggccaaacatcaat
ccaaagcttagggcgtttgctgatgaggttgcgaagaagtacgagatacccctacaagtt
gagccatccccaaggccaactggaaccgatgcgaacgtcatgcagataaacagggagggc
gttgctactgctgtgctaagcatcccaataaggtacatgcacagccaagtcgagcttgcg
gatgctagggatgtcgacaatacgataaagcttgctaaggccctattagaggagctcaag
cccatggacttaactccgtga

DBGET integrated database retrieval system