KEGG   Pyrococcus abyssi: PAB2376Help
Entry
PAB2376           CDS       T00024                                 

Gene name
bgal
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pab  Pyrococcus abyssi
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pab00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pab00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1500164..1501615
Genome map
AA seq 483 aa AA seqDB search
MEFYWGVVQSAFQFEMGDPYRRNLDTRSDWWHWVRDPYNIKNELVSGDLPEEGINNYELY
EIDHRLAKELGLNAYQLTIEWSRIFPCPTYSVEVEVERDGYGFIKSVKIRKEHLEKLDEL
ANKREVRHYENVLKNLKKLNFTTFVTLNHQTNPIWLHDPIEVRVNIEKARARGWVDERAI
VEFSKFAAYVAWKFDKYVDFWATFDEPMVTAELGYLAPYVGWPPGILNPKAAKSVIMHQI
IAHARAYDSIKKFSDKPVGVILNIIPAYPLNPRDSKHVKAAENYDLFHNRLFLEAVNKGK
LDIDINGEYVKVPHLKRNDWIGNNYYTREVVKYVEPKYKELPLVTFVGVEGYGYSANPNS
ISPDNNPTSDFGWEVYPKGLYDSTAEAYEYSEMVFITENGIADSKDILRPRYIVDHVKEV
KRLRENGINVLGYFHWALTDNYEWAMGFKIRFGLYEVDPITKERIPRRKSVETYKKVVKE
GIE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggagttttactggggggtcgttcagtcggcatttcagttcgagatgggggatccatat
aggaggaaccttgacactagaagtgactggtggcactgggttagggacccatataatata
aagaatgaactcgttagcggtgatcttccagaggaagggataaacaactacgagctatat
gagatagatcacaggttagctaaagaactcggcttaaacgcttatcaactaacgatagag
tggagcaggatattcccatgccccacgtatagcgttgaagttgaagtggaaagagatggg
tacggatttataaaatccgtgaaaattaggaaagaacatttggaaaaactggatgaactt
gcgaataagagagaagttagacactatgagaacgttctgaaaaatctcaagaagttgaac
ttcacgacgttcgtgacattgaatcatcaaactaatccaatatggctacacgatcctata
gaggttagggtgaacatagaaaaggccagagctaggggatgggtagatgaaagagccatc
gtagagttttcgaagttcgcagcttatgtagcctggaaattcgacaagtacgtagacttc
tgggccacctttgatgaacctatggttaccgccgagctcgggtacctagcaccgtacgta
ggatggcccccaggaattctgaacccgaaggccgctaagagcgtgataatgcaccaaata
atagcacatgccagggcatatgactcgataaagaagttctcagataagcccgttggggta
atattgaacataattccggcttatcccctgaacccaagggacagcaaacatgtaaaggcc
gccgaaaactacgatctattccacaacaggctcttcctggaagctgtgaataagggaaag
cttgacattgacataaatggagagtacgttaaggttccccatttaaagaggaacgactgg
atagggaacaactattacacgagggaggttgtcaagtacgtggagccaaagtacaaggag
ttacccttggtaactttcgttggagttgaaggatacggttattcagcaaatccgaacagc
atttcaccggacaataatccaacgagcgacttcggatgggaagtttatccaaaaggacta
tacgattcaacggccgaggcctacgagtacagtgagatggtcttcataacggagaacggg
atagcagattccaaggatatcctaagacccaggtacatagttgaccacgttaaagaggtt
aaaaggctcagggaaaacgggattaacgttttaggatacttccactgggccctcacggac
aattacgaatgggccatggggtttaaaattagattcgggctttatgaggtcgatccaata
acgaaggaaaggattccgaggaggaagagcgttgaaacttacaaaaaggttgtcaaggag
gggattgaatga

DBGET integrated database retrieval system