KEGG   Pyrococcus abyssi: PAB2376Help
Entry
PAB2376           CDS       T00024                                 

Gene name
bgal
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pab  Pyrococcus abyssi
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PAB2376 (bgal)
  Lipid metabolism
   00600 Sphingolipid metabolism
    PAB2376 (bgal)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PAB2376 (bgal)
Enzymes [BR:pab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PAB2376 (bgal)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1500164..1501615
Genome map
AA seq 483 aa AA seqDB search
MEFYWGVVQSAFQFEMGDPYRRNLDTRSDWWHWVRDPYNIKNELVSGDLPEEGINNYELY
EIDHRLAKELGLNAYQLTIEWSRIFPCPTYSVEVEVERDGYGFIKSVKIRKEHLEKLDEL
ANKREVRHYENVLKNLKKLNFTTFVTLNHQTNPIWLHDPIEVRVNIEKARARGWVDERAI
VEFSKFAAYVAWKFDKYVDFWATFDEPMVTAELGYLAPYVGWPPGILNPKAAKSVIMHQI
IAHARAYDSIKKFSDKPVGVILNIIPAYPLNPRDSKHVKAAENYDLFHNRLFLEAVNKGK
LDIDINGEYVKVPHLKRNDWIGNNYYTREVVKYVEPKYKELPLVTFVGVEGYGYSANPNS
ISPDNNPTSDFGWEVYPKGLYDSTAEAYEYSEMVFITENGIADSKDILRPRYIVDHVKEV
KRLRENGINVLGYFHWALTDNYEWAMGFKIRFGLYEVDPITKERIPRRKSVETYKKVVKE
GIE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggagttttactggggggtcgttcagtcggcatttcagttcgagatgggggatccatat
aggaggaaccttgacactagaagtgactggtggcactgggttagggacccatataatata
aagaatgaactcgttagcggtgatcttccagaggaagggataaacaactacgagctatat
gagatagatcacaggttagctaaagaactcggcttaaacgcttatcaactaacgatagag
tggagcaggatattcccatgccccacgtatagcgttgaagttgaagtggaaagagatggg
tacggatttataaaatccgtgaaaattaggaaagaacatttggaaaaactggatgaactt
gcgaataagagagaagttagacactatgagaacgttctgaaaaatctcaagaagttgaac
ttcacgacgttcgtgacattgaatcatcaaactaatccaatatggctacacgatcctata
gaggttagggtgaacatagaaaaggccagagctaggggatgggtagatgaaagagccatc
gtagagttttcgaagttcgcagcttatgtagcctggaaattcgacaagtacgtagacttc
tgggccacctttgatgaacctatggttaccgccgagctcgggtacctagcaccgtacgta
ggatggcccccaggaattctgaacccgaaggccgctaagagcgtgataatgcaccaaata
atagcacatgccagggcatatgactcgataaagaagttctcagataagcccgttggggta
atattgaacataattccggcttatcccctgaacccaagggacagcaaacatgtaaaggcc
gccgaaaactacgatctattccacaacaggctcttcctggaagctgtgaataagggaaag
cttgacattgacataaatggagagtacgttaaggttccccatttaaagaggaacgactgg
atagggaacaactattacacgagggaggttgtcaagtacgtggagccaaagtacaaggag
ttacccttggtaactttcgttggagttgaaggatacggttattcagcaaatccgaacagc
atttcaccggacaataatccaacgagcgacttcggatgggaagtttatccaaaaggacta
tacgattcaacggccgaggcctacgagtacagtgagatggtcttcataacggagaacggg
atagcagattccaaggatatcctaagacccaggtacatagttgaccacgttaaagaggtt
aaaaggctcagggaaaacgggattaacgttttaggatacttccactgggccctcacggac
aattacgaatgggccatggggtttaaaattagattcgggctttatgaggtcgatccaata
acgaaggaaaggattccgaggaggaagagcgttgaaacttacaaaaaggttgtcaaggag
gggattgaatga

DBGET integrated database retrieval system