KEGG   Propionibacterium acnes KPA171202: PPA0090Help
Entry
PPA0090           CDS       T00188                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:pac01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pac01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pac00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pac00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pac00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pac00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:pac00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
102809..104017
Genome map
AA seq 402 aa AA seqDB search
MIATMDRSVVGAIHGRMGTTRHRSGVVMSKKKKVGILTAGGDCPGLNAAIRGFGKAAIRQ
HDMELIGIQDGFLGLAGNRTISLDPRALSGILTVGGTILGTSRDKVNHMIIDGEERDMVP
TIVENYEKLGLDALVTLGGGGTAKNAYKLAKAGLNVLHLPKTIDNDIVGTDDSFGFSTAL
EIATEAIDRLHSTAHSHHRIILAEIMGHRAGWLALGSGIAGGADVILLPEVPYKLDSIVQ
AVENRQKQGLNFSVIAVAEGARDEADSAAMAGAQALVDASKTSETKAAAKKAKKDLEHSM
RDNTLKLATQLEEATGLESRVSILGYVQRGGIPCAHDRLLATRLGTVGAKLVDDGEFGIM
VAAQGGDATTVPLKDVAGKVKYVPADHPWVKAARQVGTGLGD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgattgccacaatggaccgcagtgttgtcggcgccatccatggaaggatgggtaccacc
cgacacagatcaggagtcgtcatgtccaaaaagaagaaggtcggcatcctcaccgcaggc
ggtgattgccccgggctcaacgccgctatccgcggatttggcaaggctgccatccgccag
cacgacatggagctcatcggtattcaggacggctttcttggattggcagggaaccgcacc
atctcccttgacccgcgtgccctctcaggcatcttgacggtcggcgggaccatcctggga
actagccgtgacaaggtcaatcacatgattatcgacggcgaggaacgggatatggtcccc
accatcgtcgagaattacgagaagctgggacttgacgctttggtgactttgggtggcggt
ggcaccgccaagaacgcgtacaagctcgctaaggccgggctgaacgtcctgcatctgccc
aagacgattgacaacgacatcgtcggaaccgacgactccttcgggttctcgacagcactg
gagattgccacggaggccatcgaccggctgcactccaccgcccattcccaccaccgcatc
atcctcgctgagatcatgggccaccgtgccggctggctggccctcggctcgggcatcgct
ggtggcgctgacgtcatcctgctgcccgaggtgccctacaagctggactccatcgtccag
gcggtggaaaaccggcaaaagcaggggttgaatttctcggtcatcgcggtggctgaggga
gctcgcgatgaggctgattcggccgcgatggctggagctcaggccctcgttgacgcttcc
aagacctccgagacaaaggcggctgccaagaaggccaagaaggaccttgagcattccatg
cgtgacaacaccctcaaattggctactcagcttgaggaggccaccgggctggaatcgcga
gtctcgatcctcggctatgtgcagcgcggtggtatcccgtgcgcccacgaccgtctgctc
gcgacccggctgggaaccgtgggtgccaagctcgttgacgacggcgagttcggcatcatg
gtcgccgctcagggcggagacgccacgaccgttccgttgaaagatgtcgctggcaaggtt
aaatacgtacctgccgaccacccatgggttaaggcggcccgtcaggtcggaaccggtcta
ggcgactga

DBGET integrated database retrieval system