KEGG   Propionibacterium acnes KPA171202: PPA0090Help
Entry
PPA0090           CDS       T00188                                 

Definition
(GenBank) 6-phosphofructokinase 2
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPA0090
   00030 Pentose phosphate pathway
    PPA0090
   00051 Fructose and mannose metabolism
    PPA0090
   00052 Galactose metabolism
    PPA0090
  Energy metabolism
   00680 Methane metabolism
    PPA0090
Enzymes [BR:pac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PPA0090
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     PPA0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
102809..104017
Genome map
AA seq 402 aa AA seqDB search
MIATMDRSVVGAIHGRMGTTRHRSGVVMSKKKKVGILTAGGDCPGLNAAIRGFGKAAIRQ
HDMELIGIQDGFLGLAGNRTISLDPRALSGILTVGGTILGTSRDKVNHMIIDGEERDMVP
TIVENYEKLGLDALVTLGGGGTAKNAYKLAKAGLNVLHLPKTIDNDIVGTDDSFGFSTAL
EIATEAIDRLHSTAHSHHRIILAEIMGHRAGWLALGSGIAGGADVILLPEVPYKLDSIVQ
AVENRQKQGLNFSVIAVAEGARDEADSAAMAGAQALVDASKTSETKAAAKKAKKDLEHSM
RDNTLKLATQLEEATGLESRVSILGYVQRGGIPCAHDRLLATRLGTVGAKLVDDGEFGIM
VAAQGGDATTVPLKDVAGKVKYVPADHPWVKAARQVGTGLGD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgattgccacaatggaccgcagtgttgtcggcgccatccatggaaggatgggtaccacc
cgacacagatcaggagtcgtcatgtccaaaaagaagaaggtcggcatcctcaccgcaggc
ggtgattgccccgggctcaacgccgctatccgcggatttggcaaggctgccatccgccag
cacgacatggagctcatcggtattcaggacggctttcttggattggcagggaaccgcacc
atctcccttgacccgcgtgccctctcaggcatcttgacggtcggcgggaccatcctggga
actagccgtgacaaggtcaatcacatgattatcgacggcgaggaacgggatatggtcccc
accatcgtcgagaattacgagaagctgggacttgacgctttggtgactttgggtggcggt
ggcaccgccaagaacgcgtacaagctcgctaaggccgggctgaacgtcctgcatctgccc
aagacgattgacaacgacatcgtcggaaccgacgactccttcgggttctcgacagcactg
gagattgccacggaggccatcgaccggctgcactccaccgcccattcccaccaccgcatc
atcctcgctgagatcatgggccaccgtgccggctggctggccctcggctcgggcatcgct
ggtggcgctgacgtcatcctgctgcccgaggtgccctacaagctggactccatcgtccag
gcggtggaaaaccggcaaaagcaggggttgaatttctcggtcatcgcggtggctgaggga
gctcgcgatgaggctgattcggccgcgatggctggagctcaggccctcgttgacgcttcc
aagacctccgagacaaaggcggctgccaagaaggccaagaaggaccttgagcattccatg
cgtgacaacaccctcaaattggctactcagcttgaggaggccaccgggctggaatcgcga
gtctcgatcctcggctatgtgcagcgcggtggtatcccgtgcgcccacgaccgtctgctc
gcgacccggctgggaaccgtgggtgccaagctcgttgacgacggcgagttcggcatcatg
gtcgccgctcagggcggagacgccacgaccgttccgttgaaagatgtcgctggcaaggtt
aaatacgtacctgccgaccacccatgggttaaggcggcccgtcaggtcggaaccggtcta
ggcgactga

DBGET integrated database retrieval system