KEGG   Cutibacterium acnes KPA171202: PPA0118Help
Entry
PPA0118           CDS       T00188                                 

Definition
(GenBank) two-component sensor, KdpD
  KO
K07646  two-component system, OmpR family, sensor histidine kinase KdpD [EC:2.7.13.3]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac02020  Two-component system
Module
pac_M00454  KdpD-KdpE (potassium transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:pac00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PPA0118
Enzymes [BR:pac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     PPA0118
Protein kinases [BR:pac01001]
 Histidine kinases
  OmpR family
   PPA0118
Two-component system [BR:pac02022]
 OmpR family
  KdpD-KdpE [MD:M00454]
   PPA0118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KdpD DUF4118 HATPase_c HisKA Usp HATPase_c_2 DUF2269 AAA_19
Motif
Other DBs
NCBI-ProteinID: AAT81878
UniProt: Q6ABI9
Position
141989..144481
Genome map
AA seq 830 aa AA seqDB search
MAVRGRLRVLLGAAPGVGKTYAMLDEGKHLRAGGSDVVIAVVETHGRAATAAMTEGMEVI
PRHYVECRGIELPEMDLDGVLAQHPDVALVDELAHTNAPGSRNEKRWQDVEELLEAGIDV
ISTVNIQHIESLNDVVEQITGVPQRETVPDTVLRRASQVEVVDLAPQALRDRLSSGKVYP
AERIDAALSNYFRLGNLTALRELALLWVADEVDHALADYRSEHGIDSRWEARERVVVALT
GGREGETLLRRGARIAVRAGGGELLAVHVTTEDGLRSPHPGELARQRGLVDKLGGSFHQL
VGDDIPETLIEFAKSVNATQLVIGASRRGKLSRLLTGHDVEADIIRASGAIDVHIVSHDA
QAKALRLPRMGGSLSTRRRIAGFAVLAVLGPLLTLLLVSSRSPEALTTDVLAYELLAVVV
ALVGGAFSSLIAALASGFALDYFFTKPFYTVTVNEPLHLVALLLYLLTAALVSVVVDRAA
RKTRVARRAAAESGLLQSVAGLVLRGEDAVESLLSRATEAFGLSGARLMTDGKVVANWGT
TSDQVTEHRIDDHTVVEFHGPEPDASERRLMSVIAAQLGTALEQHQLEETAKAVEPLAAT
DRVRTALLSAVGHDLRRPLAAATAAVSGLRSEWSKLSDQDRADLLETADEALSQLANLVT
DLLDVSRLQSGVLGVSVMPVDPAEVIMPALDELSLGPADVEIDLGSDVPEMVADPALLQR
VVVNLLSNALRYEPAGSRVRLAESSFANQVEIRVIDHGPGIPEDRRDDVMVPFQRLGDTD
SSVGLGLGLALSKGFVEGMDGTLALEDTPGGGLTMVISLPRVGVEEASVQ
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
gtggctgttcggggaaggttgcgggtgctgctgggcgcggcaccgggcgtcggcaagacc
tacgccatgcttgacgagggcaagcacctgcgcgccggggggtctgatgtcgttatcgcc
gttgttgagactcacggccgggcagctactgcggcaatgaccgaggggatggaggtcatc
ccgcggcactacgtcgagtgccgtggcattgagctgccggagatggatcttgacggggtg
ctggcccagcaccctgacgtcgccctcgtcgacgaacttgcccacaccaacgcccccggg
tcccgtaatgagaagcgttggcaggacgttgaggagcttctggaggccgggattgacgtc
atctcgacggtcaacatccagcacatcgagtctctcaacgacgtcgttgagcaaatcact
ggggtaccacagcgcgagactgtcccggacaccgtgctgcgcagggccagccaggtggag
gtcgtcgacctcgccccgcaggccctgcgcgaccgattgtcgagcggcaaggtgtatccg
gccgagcggatcgacgcggccttgtcaaactacttccggctcggcaatctcaccgccctg
cgtgagttggccttgttgtgggtggccgacgaggtcgatcacgcgctggccgactaccgt
agcgagcacggtatcgactcccgttgggaagcccgtgaacgggtagtcgtcgccctgaca
gggggtcgggaaggcgaaaccctgttgcgacgcggtgcccggatcgcggttcgagccggt
ggcggagagttgctggcggtgcacgtcaccaccgaggacgggctgcgctccccgcatccg
ggggaactagcccggcaacgagggttggtggacaagctaggaggatccttccaccagctc
gttggcgatgacatccccgagactctcatcgagttcgcgaagtcggtcaacgccacccag
ctcgtcatcggggctagtcggcgcggcaaactttcgcggctgttgaccggacacgacgtc
gaggcagacattatccgggcttccggtgctatcgacgttcacatcgtcagtcatgacgcc
caggcgaaggcgctgcgtttgccgcggatgggtgggtcgttgtcgacgcggcgtcggatc
gctggtttcgctgtgctggcggtgctcgggccactcttgacgttgctgttggtgtcgtcg
cgtagcccggaggcgctgacgaccgatgtgctggcttacgagttgctggccgtcgtggtg
gccttggtaggtggggcattttcgtcgctcattgcggctctggcctcgggttttgcgctg
gactattttttcactaaacctttctacaccgtcaccgtcaacgaaccgttacacctggtg
gcactgttgctgtacctgctcaccgcggccctggtgagtgttgttgtcgatcgcgctgcc
cgtaagaccagggtggctcgacgcgccgccgctgagtcgggactgttgcagtcggtggcc
ggtttggtgctgcgcggcgaggacgccgttgagtcgttgttgtccagggcgactgaggct
ttcgggttatctggggcgcgattgatgaccgacggaaaggttgtggcaaattggggtaca
acgagtgatcaagtcacggagcatcgcatcgacgaccataccgtggtggaattccacggc
ccggagccggacgcctcggagcgtcggctgatgtcggtcatcgccgcccagttggggaca
gccttggagcagcatcagctggaggagacggcgaaggcggtggagccgttagcggccacc
gaccgggtgcgcacggcgttgttgtcagcggtcggtcacgacctgcgccgccccctggcg
gctgccaccgccgctgtgtctgggctgcgcagcgagtggtcgaagctttctgaccaagat
cgtgccgatttgttggaaaccgctgatgaggcgttgtcgcagttggcgaatttggtcacc
gaccttctcgacgtctcccggttgcagtcgggggtgctgggggtctcggtgatgccggta
gacccggctgaggtcatcatgccggcgctggacgagttgtccctggggccggccgacgtc
gagatcgacctgggttctgacgttcccgagatggtcgccgacccagccttgctgcagcga
gttgtcgtcaacctgttgtcgaatgcgctgcgttacgagccggcgggcagccgggtgcgg
ttggcggagagtagcttcgccaaccaggtggagattcgagtcatcgatcacggcccgggg
attccagaggaccgtcgcgacgatgtcatggtgcctttccagcggctgggtgatacggat
tccagcgtagggctggggcttggcctggcgctgtcgaaggggttcgtcgagggaatggac
ggcaccctggccttggaggacactcccggcgggggactgacgatggtgatcagcttgccc
cgggtaggggttgaggaggcaagtgttcaatga

DBGET integrated database retrieval system