KEGG   Propionibacterium acnes KPA171202: PPA0118Help
Entry
PPA0118           CDS       T00188                                 

Definition
two-component sensor, KdpD
Orthology
K07646  
two-component system, OmpR family, sensor histidine kinase KdpD [EC:2.7.13.3]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Two-component system
Module
KdpD-KdpE (potassium transport) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pac02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
141989..144481
Genome map
AA seq 830 aa AA seqDB search
MAVRGRLRVLLGAAPGVGKTYAMLDEGKHLRAGGSDVVIAVVETHGRAATAAMTEGMEVI
PRHYVECRGIELPEMDLDGVLAQHPDVALVDELAHTNAPGSRNEKRWQDVEELLEAGIDV
ISTVNIQHIESLNDVVEQITGVPQRETVPDTVLRRASQVEVVDLAPQALRDRLSSGKVYP
AERIDAALSNYFRLGNLTALRELALLWVADEVDHALADYRSEHGIDSRWEARERVVVALT
GGREGETLLRRGARIAVRAGGGELLAVHVTTEDGLRSPHPGELARQRGLVDKLGGSFHQL
VGDDIPETLIEFAKSVNATQLVIGASRRGKLSRLLTGHDVEADIIRASGAIDVHIVSHDA
QAKALRLPRMGGSLSTRRRIAGFAVLAVLGPLLTLLLVSSRSPEALTTDVLAYELLAVVV
ALVGGAFSSLIAALASGFALDYFFTKPFYTVTVNEPLHLVALLLYLLTAALVSVVVDRAA
RKTRVARRAAAESGLLQSVAGLVLRGEDAVESLLSRATEAFGLSGARLMTDGKVVANWGT
TSDQVTEHRIDDHTVVEFHGPEPDASERRLMSVIAAQLGTALEQHQLEETAKAVEPLAAT
DRVRTALLSAVGHDLRRPLAAATAAVSGLRSEWSKLSDQDRADLLETADEALSQLANLVT
DLLDVSRLQSGVLGVSVMPVDPAEVIMPALDELSLGPADVEIDLGSDVPEMVADPALLQR
VVVNLLSNALRYEPAGSRVRLAESSFANQVEIRVIDHGPGIPEDRRDDVMVPFQRLGDTD
SSVGLGLGLALSKGFVEGMDGTLALEDTPGGGLTMVISLPRVGVEEASVQ
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
gtggctgttcggggaaggttgcgggtgctgctgggcgcggcaccgggcgtcggcaagacc
tacgccatgcttgacgagggcaagcacctgcgcgccggggggtctgatgtcgttatcgcc
gttgttgagactcacggccgggcagctactgcggcaatgaccgaggggatggaggtcatc
ccgcggcactacgtcgagtgccgtggcattgagctgccggagatggatcttgacggggtg
ctggcccagcaccctgacgtcgccctcgtcgacgaacttgcccacaccaacgcccccggg
tcccgtaatgagaagcgttggcaggacgttgaggagcttctggaggccgggattgacgtc
atctcgacggtcaacatccagcacatcgagtctctcaacgacgtcgttgagcaaatcact
ggggtaccacagcgcgagactgtcccggacaccgtgctgcgcagggccagccaggtggag
gtcgtcgacctcgccccgcaggccctgcgcgaccgattgtcgagcggcaaggtgtatccg
gccgagcggatcgacgcggccttgtcaaactacttccggctcggcaatctcaccgccctg
cgtgagttggccttgttgtgggtggccgacgaggtcgatcacgcgctggccgactaccgt
agcgagcacggtatcgactcccgttgggaagcccgtgaacgggtagtcgtcgccctgaca
gggggtcgggaaggcgaaaccctgttgcgacgcggtgcccggatcgcggttcgagccggt
ggcggagagttgctggcggtgcacgtcaccaccgaggacgggctgcgctccccgcatccg
ggggaactagcccggcaacgagggttggtggacaagctaggaggatccttccaccagctc
gttggcgatgacatccccgagactctcatcgagttcgcgaagtcggtcaacgccacccag
ctcgtcatcggggctagtcggcgcggcaaactttcgcggctgttgaccggacacgacgtc
gaggcagacattatccgggcttccggtgctatcgacgttcacatcgtcagtcatgacgcc
caggcgaaggcgctgcgtttgccgcggatgggtgggtcgttgtcgacgcggcgtcggatc
gctggtttcgctgtgctggcggtgctcgggccactcttgacgttgctgttggtgtcgtcg
cgtagcccggaggcgctgacgaccgatgtgctggcttacgagttgctggccgtcgtggtg
gccttggtaggtggggcattttcgtcgctcattgcggctctggcctcgggttttgcgctg
gactattttttcactaaacctttctacaccgtcaccgtcaacgaaccgttacacctggtg
gcactgttgctgtacctgctcaccgcggccctggtgagtgttgttgtcgatcgcgctgcc
cgtaagaccagggtggctcgacgcgccgccgctgagtcgggactgttgcagtcggtggcc
ggtttggtgctgcgcggcgaggacgccgttgagtcgttgttgtccagggcgactgaggct
ttcgggttatctggggcgcgattgatgaccgacggaaaggttgtggcaaattggggtaca
acgagtgatcaagtcacggagcatcgcatcgacgaccataccgtggtggaattccacggc
ccggagccggacgcctcggagcgtcggctgatgtcggtcatcgccgcccagttggggaca
gccttggagcagcatcagctggaggagacggcgaaggcggtggagccgttagcggccacc
gaccgggtgcgcacggcgttgttgtcagcggtcggtcacgacctgcgccgccccctggcg
gctgccaccgccgctgtgtctgggctgcgcagcgagtggtcgaagctttctgaccaagat
cgtgccgatttgttggaaaccgctgatgaggcgttgtcgcagttggcgaatttggtcacc
gaccttctcgacgtctcccggttgcagtcgggggtgctgggggtctcggtgatgccggta
gacccggctgaggtcatcatgccggcgctggacgagttgtccctggggccggccgacgtc
gagatcgacctgggttctgacgttcccgagatggtcgccgacccagccttgctgcagcga
gttgtcgtcaacctgttgtcgaatgcgctgcgttacgagccggcgggcagccgggtgcgg
ttggcggagagtagcttcgccaaccaggtggagattcgagtcatcgatcacggcccgggg
attccagaggaccgtcgcgacgatgtcatggtgcctttccagcggctgggtgatacggat
tccagcgtagggctggggcttggcctggcgctgtcgaaggggttcgtcgagggaatggac
ggcaccctggccttggaggacactcccggcgggggactgacgatggtgatcagcttgccc
cgggtaggggttgaggaggcaagtgttcaatga

DBGET integrated database retrieval system