KEGG   Propionibacterium acnes KPA171202: PPA0143Help
Entry
PPA0143           CDS       T00188                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPA0143
   01230 Biosynthesis of amino acids
    PPA0143
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPA0143
   00030 Pentose phosphate pathway
    PPA0143
   00051 Fructose and mannose metabolism
    PPA0143
   00052 Galactose metabolism
    PPA0143
  Energy metabolism
   00680 Methane metabolism
    PPA0143
Enzymes [BR:pac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PPA0143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(171619..172569)
Genome map
AA seq 316 aa AA seqDB search
MIVTVTLNPSIDRTAPIAGPLRRGQVNRLGSSTEVAAGKGVNISRVLRGAGIETCAVVPA
GAKGRLTLGLNHDDIPHQVVPVAAAVRTNLTITEPDGTTTKINEPGADLSPEELTAVEEA
IVEKSSGAQWVVLSGSLPPGVPTHWYATMTDRLHEIGVKVAVDTSDQPLQELAARLPDCA
PDLVKPNSVELGQLCGIDGDSLESAATRGQFDDVVVAARGLHGIAEVIVTLGGTGALLIT
EHDAWHARPEPVEVKSTVGAGDSSLAGFLLARTRGDQPENCLRAAVAWGTAAAALPGSTM
PTPSQADAIHVSLTHL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtcaccgtcacgctcaacccgagcattgaccgcacagcgcccatagctgggccg
ctgcggcgcggtcaggtgaaccgactcggcagttccaccgaggtcgccgccggtaagggg
gtcaacatctcgcgagtccttcgtggggctggaatcgaaacctgcgccgtggtgccagcc
ggagccaagggccgcctgaccctcggcctcaaccacgacgacatcccgcaccaagttgta
cccgttgcggcagcggtgagaaccaacctcaccatcaccgaacctgacggcactacaacc
aagatcaatgagcccggagccgacctcagtcctgaggagctgaccgcagttgaggaggcc
atcgtcgagaagtcctccggcgcgcaatgggtcgtactgtcaggatccttacccccgggc
gtacccacacattggtatgccacaatgaccgaccgcctccatgagatcggcgtcaaagtc
gccgtcgacacctccgatcaacccctccaagagctggcggcccgcctccccgactgtgcc
cctgaccttgtcaagccgaactccgtcgagctcggccaactatgcgggattgacggcgac
tctctcgagtctgctgccacaaggggacagttcgacgacgttgtcgtggccgcccgaggt
ctgcacggcatcgccgaggtaatcgtcaccttgggcgggaccggcgctctgctcatcacc
gaacacgacgcctggcacgcccggccagagccggtcgaggtgaagtcgactgttggcgcc
ggagactcctccctggccggattcctgctggcgcgcacccgcggcgaccagcccgaaaac
tgcctgcgcgccgccgtggcgtggggcacagcagccgccgctctaccggggtcaaccatg
ccgaccccgtcacaggccgacgccattcacgtcagcctcacccacctgtaa

DBGET integrated database retrieval system