KEGG   Propionibacterium acnes KPA171202: PPA0261Help
Entry
PPA0261           CDS       T00188                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PPA0261
Enzymes [BR:pac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PPA0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
315622..316197
Genome map
AA seq 191 aa AA seqDB search
MKLSVDRERAAAAIREFLLAVGEDPDREGLRDTPMRVAQAAEELFGGLSQDPGELLATTF
DISHDEMVLVRDIELQSMCEHHLLPFIGVAHVGYIPARDGRVTGLSKIARLVEVYARRPQ
VQERLTTQVADALVEHLDARGVIVVVEAEHMCMTTRGVRKPGARTVTSAVRGILRNPATR
AEAMGLITAGR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtccgttgatcgcgagcgagccgcggcagctatccgcgagtttcttctggcg
gtcggcgaggatcccgatcgggaaggcctgcgcgatactccaatgcgagtggcccaggcg
gccgaggagctatttggcggattgagccaagatccgggggagttgctggcaacgaccttc
gacatctcccacgacgagatggtgttggtgcgtgatattgagttgcagtcgatgtgtgag
caccatctgctgcccttcatcggggtagcgcacgtcggttatattccggctagggacggc
cgggtgacggggttgagtaagatcgcgaggttggtggaggtctatgcgcgtcgaccccag
gtacaggagaggttgacgacccaggtggccgacgccttggtagaacatttggacgctcgt
ggcgtgatcgtggttgttgaggccgagcacatgtgcatgacgacgaggggggtccgcaag
ccgggggcccggacggtgacctccgcggtgcgcgggattctgcgcaacccagcgacgcgg
gccgaggcgatggggctgatcacggctggacgttga

DBGET integrated database retrieval system