KEGG   Propionibacterium acnes KPA171202: PPA0271Help
Entry
PPA0271           CDS       T00188                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PPA0271
Enzymes [BR:pac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PPA0271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
321592..322437
Genome map
AA seq 281 aa AA seqDB search
MINVGSATNSHPARTLVMGVVNVTPNSFSDGGMWADPEVAIRHARDLVVEGADIIDVGGE
STRPGTERTPEHEELRRVLPVVKALVADGVAVSVDTMRASVAKAVVEAGATIVNDVSGGK
AEPEILDVVADAGVDYVLMHWRGQSATMQNLVDYDDVVADVISETSQQVDAAIAAGIDRR
RIIVDPGIGFSKTSEHNWQLMNAVDAFQEGFADLRVLWGVSRKRFLGELLAQNGEDRPAL
ERDASTMALSTYFALHHAWCVRTHEVRANRDAVETVARLLA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatgtcggctcggctaccaactcgcatcccgcccgcaccctcgtcatgggggtc
gtcaacgtcactcctaactcgttctctgacggaggcatgtgggccgatcctgaggtggcc
atccgccacgctcgcgacctcgttgtcgaaggagctgacatcatcgacgtcggtggtgaa
tcgacccgtccgggcaccgaacgcacccccgagcacgaagaattgcgccgcgtcctgccc
gtcgtcaaagctttggtggccgacggggtagccgtctccgtcgacactatgcgcgcctca
gtggccaaggctgttgtcgaggcaggagccaccatcgtcaacgacgtctctgggggcaag
gctgaaccggaaatccttgatgtcgttgccgacgctggcgtcgattacgttctcatgcac
tggcgcggtcaatccgccactatgcagaaccttgtcgactatgacgacgtggtagccgac
gtcatttctgagacctcccagcaggtcgacgcagctattgccgctggaatcgaccgtagg
cgcatcatcgtcgacccgggcattggtttctccaagacttccgagcacaactggcagctc
atgaacgccgttgacgccttccaagaaggatttgccgaccttcgtgtcctgtggggagtt
agtcgcaagcgcttccttggtgaacttctcgcccagaacggggaggaccgtccggccctc
gaacgcgatgcgagcaccatggccctgtcgacttatttcgcccttcatcacgcctggtgt
gtgcgcacccacgaagttcgggccaaccgcgacgccgtggagactgttgcccgccttctc
gcctga

DBGET integrated database retrieval system