KEGG   Propionibacterium acnes KPA171202: PPA0273Help
Entry
PPA0273           CDS       T00188                                 

Definition
hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PPA0273
Enzymes [BR:pac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PPA0273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
322857..323414
Genome map
AA seq 185 aa AA seqDB search
MKTVFSLGSNMGDPFAHLRDAVRLIAETPGIHDVVVSPVYVTAPIGGVEQDDFLNLIVVA
TSDLPPSVLLERAHVIEAAHGRDHTIPNGPRTLDVDLIRVGDETVTTDELTLPHPRAHKR
AFVLVPWRDADPEAELPGYGRIADLVASFDADELADAVKPYSRQIDVAGVTVAGEWDERH
DEEDV
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaccgtattcagcctgggttccaatatgggagacccttttgcccatctgcgagac
gccgtccgcctgatcgccgaaactcccggtattcacgacgtcgtcgtttcgcccgtctat
gtcaccgctccgatcgggggagtggagcaggatgacttcctcaacctcatcgtcgttgcg
actagcgaccttcctccgtcagtcctgttggagcgcgcccatgtcatcgaggcagcccac
gggcgcgatcacaccatcccgaatggtcctcgcaccctcgacgttgatctcattcgcgtt
ggcgacgagaccgtcaccaccgacgagttgacccttccacacccccgtgcacataagcgc
gccttcgttctggtgccgtggcgcgacgccgaccctgaggctgaattgcccgggtacggt
cggatcgccgatctggtcgcctccttcgatgctgacgagctggctgacgccgttaagcct
tattcgcgtcagattgacgtagctggggtcaccgttgcaggagaatgggacgagaggcac
gacgaggaggatgtatga

DBGET integrated database retrieval system