KEGG   Cutibacterium acnes KPA171202: PPA0302Help
Entry
PPA0302           CDS       T00188                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase, HemB
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00860  Porphyrin and chlorophyll metabolism
pac01100  Metabolic pathways
pac01110  Biosynthesis of secondary metabolites
pac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PPA0302
Enzymes [BR:pac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PPA0302
Exosome [BR:pac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPA0302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD OMS28_porin
Motif
Other DBs
NCBI-ProteinID: AAT82059
UniProt: Q6AB07
Position
complement(352402..353448)
Genome map
AA seq 348 aa AA seqDB search
MNPYLPDASDPRMAGVKPLPEGLRPVSRPRRLRTTPAMRRMVAETRVAPAQLMLPAFVKE
GIDSPVEITSLPGQFQHSTESIKELATQAAEAGIGGIDLFGIPEHKDEIGSQAWDLKGIL
NAGISAVREAVGDDLVICADTCLDEFTDHGHCGALTPDGRVDNDSTVPLYAAMAVSQARA
GAHMVSPSGMMDGQIAVIRDTLDREGFTDVSIMAYSAKYASAFFGPFRDAVNCSLKGDRK
TYQQDPPNRREGLRETLLDLAEGADLVMVKPASHYLDVLSDVAEVSQVPVAAYQVSGEYA
MLEAAAANGWIDRRRCIGESLTSIVRAGADLVLTYWAIEAAQMFREDL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtacctgcctgatgccagtgatccccgcatggctggggtcaagccattgccc
gaggggctgcgtcctgtttctcgtccgcgtcgactacgcaccactcctgcgatgcgccgg
atggtcgccgaaacccgcgtcgcccccgcccagttaatgctgccggcgttcgtcaaagag
gggatcgattcccccgtcgagatcaccagcctgcccggccaattccagcactccaccgag
tcgatcaaggagctcgccacccaagctgccgaggccggtattggtggtattgacctgttt
ggtatcccggagcacaaagacgagatcggttctcaggcctgggacctgaaaggcatcctc
aacgccggcatctccgcggtgcgcgaggccgtcggcgacgatctggtgatctgtgccgac
acctgtctagacgagttcaccgatcatggacactgcggagctctgacccctgatggtcgc
gtcgataatgactccactgtgccgctatatgccgcgatggcggtctcccaagcgcgcgcc
ggagcccacatggtctccccgtcggggatgatggacggtcagatcgctgtcattcgcgat
actctggatcgcgagggattcaccgatgtgtccatcatggcctattcagctaagtacgct
tcagccttctttggccccttccgcgacgccgtcaactgttcccttaagggtgatcgcaag
acttaccagcaggatccaccgaaccgccgggaaggcctgcgcgaaacccttctcgacctc
gccgagggagccgacctggtcatggtgaagcccgcctcccactacctcgacgtgttgtcc
gatgtcgccgaggtgtcgcaggtaccggttgccgcttaccaggtctctggagaatacgcc
atgctcgaggccgctgccgcaaacggttggatcgatcgtcgacgttgcatcggagagtcc
ctgacctcgatcgtgcgtgccggtgccgatcttgtcttgacctactgggcaatcgaggcg
gcgcagatgtttcgcgaggacctctga

DBGET integrated database retrieval system