KEGG   Cutibacterium acnes KPA171202: PPA0303Help
Entry
PPA0303           CDS       T00188                                 

Definition
(GenBank) uroporphyrinogen-III synthase, HemD
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00860  Porphyrin and chlorophyll metabolism
pac01100  Metabolic pathways
pac01110  Biosynthesis of secondary metabolites
pac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PPA0303
Enzymes [BR:pac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PPA0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AAT82060
UniProt: Q6AB06
Position
complement(353478..354203)
Genome map
AA seq 241 aa AA seqDB search
MTTNPADLVKPPVVVPRDDSHDKFVTTLKQAGYGVIHTALTRTVTLPDAERLTAPDLWQA
DWLVVTSKTTVGLLPTPLPNPNIKVAAVGAATSAALRTRGIDVDFVPENHSGAGLVAEWP
GGVANILLPASQLTADTVPLGLTKVGCTVNRLEIYTTAAVEKLPEVIAQSWPSVGVVVVT
ASSVGRALVELVEPLGWRRQKLVALGKPTARTLEVLGHPAHAVASSPTPEAVLEAVESLV
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaaatcctgccgatctcgtcaagcccccagttgttgttccccgtgacgactcc
cacgacaaattcgtgacgactttgaagcaggccggttatggagtgatccacacagcgctg
acgcgcaccgtcaccttgccggatgcggagaggcttactgcccctgacctgtggcaggcc
gactggctggtcgtcacctcgaagaccaccgtcggactgctccctaccccgttgccgaat
cccaacatcaaagtagctgcggtcggcgccgctacctctgctgcgctgcgcacacgtggg
attgacgtcgacttcgtccccgagaatcacagcggcgctggtctggtcgccgagtggcca
ggtggagtcgccaatatcctcctaccagcgtcccagttaaccgccgataccgtaccgctg
gggctgacgaaggtcggctgcacggtaaaccgattggagatctataccaccgctgccgtc
gagaaactgcctgaggtcatcgcccagtcgtggccgtctgtcggggtcgtcgtcgtcact
gcctcctcggtgggacgtgccctcgtcgagctggtggagccgctgggatggcgtcgtcag
aagctcgtcgccctcggtaagcccactgcaagaacactcgaagtactcggtcacccagcg
catgcggtggcctcctcccccactcctgaagccgtccttgaggcggttgagtccttggtc
gcctga

DBGET integrated database retrieval system