KEGG   Propionibacterium acnes KPA171202: PPA0489Help
Entry
PPA0489           CDS       T00188                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PPA0489
   00052 Galactose metabolism
    PPA0489
   00500 Starch and sucrose metabolism
    PPA0489
   00520 Amino sugar and nucleotide sugar metabolism
    PPA0489
Enzymes [BR:pac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PPA0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
540108..541505
Genome map
AA seq 465 aa AA seqDB search
MSEEGLAAARQKMTEAGVDPVAIEVFTSYYHQLETGDTGLIREDTISPLTNPPMLDDVEV
SEEQAAEALDKTVIIKLNGGLGTSMGLDRAKSLLEVRDGKSFLDIIATQVLSARKTFGAR
LPLMFMNSFNTREDTLKALEKYPELAVDGLELDFLQDQEPKLDAETLAPVEWPKDSSLEW
CPPGHGDLYTALLGSGVLDHLLEAGYQYASVSNGDNLGAVPDGRLAGWFAASGAPYAAEL
CRRTINDKKGGHLAIRKSDDQLILRDTAQTAEEEMDYFTDEHRHPFFHTNNLWFDLEALK
KVLDERHGVMGLQIIRNEKTVDPKDSSSTPVIQIESAMGGAIEVFEGATCICVDRSRFLP
VKTTNELLLLRSDVYDLDDSDHLVKTTDMTCAVDLDKDFYKKISDFDDRIPEPPSLRRAT
SLKVKGDWTFGSEVVVAGDVSLDTEKPQTIPDGTVLTGEVLGAKK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaaggacttgcggctgcacgccagaagatgaccgaggcaggtgtcgatcct
gtcgccatcgaggtcttcacttcctactaccaccagctcgagaccggcgataccggactc
atccgcgaggacaccatctccccgctcacgaatccgccaatgctcgacgacgttgaggtc
agcgaggagcaggctgctgaggccctcgacaagaccgtcatcatcaagctcaatggcggg
ctcggaacctcgatgggcctcgaccgagctaagtcgctgctcgaagttcgtgacggcaag
tccttcctcgacatcatcgctacccaggtgctctcggctcgcaagactttcggcgctcga
ttgccgctgatgttcatgaattccttcaatacccgcgaggacaccctcaaggccctcgag
aaatatccagagttggctgtcgacggcctagagctcgacttcctgcaggatcaggagcct
aagctcgacgctgagaccctcgccccggttgagtggccgaaggactcctccctcgagtgg
tgtcctccgggtcacggcgacctctacaccgctctgcttggatccggcgtcctcgaccat
ctgctcgaggctggataccaatacgcctcggtatccaatggtgacaatcttggtgccgtt
ccggacggtcgtctcgccggctggtttgcggcgtcgggtgctccctacgctgccgagttg
tgccgtcgcactattaacgacaagaagggtggccacctggccattcgtaagtctgatgat
cagctcatcctgcgcgatacggcacagacagcagaagaggaaatggattacttcaccgac
gagcatcgtcaccccttctttcacaccaacaatctgtggtttgaccttgaagccctcaag
aaggtgctggacgagcgacacggcgtgatgggcctgcaaattattcgcaacgagaagacg
gtcgacccgaaggattcctcgtcgactcctgtcatccagattgagtccgctatggggggc
gctatcgaggtctttgaaggcgctacctgtatctgtgttgatcggtcccggttcttgccg
gtcaaaacgaccaacgagctgctgctgcttcggtctgatgtttatgacctcgacgattcg
gaccacctcgtcaagaccaccgacatgacctgcgcagtcgatcttgacaaggatttttat
aaaaagattagtgatttcgacgatcgcatccctgagccgccatcgctgcgccgcgccacc
tcgctgaaggtcaaaggagactggacctttggttcggaggttgtcgttgcgggggatgtt
tcgctggatactgagaagcctcagacgattccggacgggaccgtgctcactggcgaagtc
cttggcgcgaaaaagtga

DBGET integrated database retrieval system