KEGG   Cutibacterium acnes KPA171202: PPA0609Help
Entry
PPA0609           CDS       T00188                                 

Definition
(GenBank) L-fucose isomerase
  KO
K01818  L-fucose/D-arabinose isomerase [EC:5.3.1.25 5.3.1.3]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00051  Fructose and mannose metabolism
pac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PPA0609
Enzymes [BR:pac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.3  D-arabinose isomerase
     PPA0609
    5.3.1.25  L-fucose isomerase
     PPA0609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fucose_iso_N2 Fucose_iso_C
Motif
Other DBs
NCBI-ProteinID: AAT82365
UniProt: Q6AA51
Position
672646..673701
Genome map
AA seq 351 aa AA seqDB search
MGLSIGEDRNPADKQHSDADKREQLEYSVKMVLVARDLMNGNLRLADMGFKEEAGGYDAI
AAGFQGKRQWTDGKLNGDVMETLLNTSFDSDGLRQPQVFATEGDALNGIAMLLGSLLTQR
PQFFSDVRTYWSPEAVRRVTGHELTGRAAGGFVDFRNSGASTLNATECEAEADGTPVIKH
WWDLTEDDIQADLAATTFHSATQEYFPGGGFSTHFTTVGDTTVTAVRMNMVAGVGPTLQI
VEGRTLPDEGTDTIVERADPTWPTTFFVSRIPSSGAFSSVYDWMDKWGANHTSTGYSHIG
ADVLTLAAMLRIPVSMHNIETKDIFRPRTWSSSEPSSNRRARDTDRRVRPS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggtctcagcatcggtgaggaccgaaatccggctgacaagcagcacagcgatgctgac
aagcgtgaacagctggagtattcggtcaagatggtgctggttgcccgagacctcatgaac
ggcaatttgcgtctggccgacatgggattcaaggaagaggccggtggttacgacgccatc
gccgccggcttccagggcaagcgtcagtggactgatggcaagctgaacggcgacgtcatg
gaaaccctgctcaacaccagcttcgactcggatggactgcgtcagccccaggtctttgcc
accgagggagatgccctcaacgggatagcgatgctgctcggcagcctcctcactcagcgt
cctcagttctttagcgatgtccgtacctattggagcccggaggccgttcgccgcgtcacc
ggtcatgagctgaccggtcgtgccgctggtggtttcgtcgatttcaggaattccggcgcg
agcactctcaacgcgacagaatgcgaggccgaggcggacggcactcccgtcatcaagcac
tggtgggatctcaccgaggacgacatccaggccgatctcgctgcgacgaccttccactcg
gcgacccaggagtacttcccgggcggcggattctcgacccacttcacgacggtgggggac
acgacggtgacagcggttcgtatgaacatggtcgctggagttggaccgaccctgcagatt
gtcgagggacggacgctcccggacgaggggacagacaccatcgttgagcgggcggacccg
acgtggccgacaacgttcttcgtgtcgcgcattccctcgagcggagccttcagtagcgtt
tatgactggatggataagtggggagctaaccacacctcgacggggtacagccatatcggc
gctgacgttctcaccctggcagccatgctgcgcatcccggtctcgatgcacaacattgag
accaaggacatcttccgtccgcgtacctggtcctcgtcggaaccgtcgtcgaaccgccgt
gcgagggataccgaccgacgagtgaggccctcatga

DBGET integrated database retrieval system