KEGG   Propionibacterium acnes KPA171202: PPA0609Help
Entry
PPA0609           CDS       T00188                                 

Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pac00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
672646..673701
Genome map
AA seq 351 aa AA seqDB search
MGLSIGEDRNPADKQHSDADKREQLEYSVKMVLVARDLMNGNLRLADMGFKEEAGGYDAI
AAGFQGKRQWTDGKLNGDVMETLLNTSFDSDGLRQPQVFATEGDALNGIAMLLGSLLTQR
PQFFSDVRTYWSPEAVRRVTGHELTGRAAGGFVDFRNSGASTLNATECEAEADGTPVIKH
WWDLTEDDIQADLAATTFHSATQEYFPGGGFSTHFTTVGDTTVTAVRMNMVAGVGPTLQI
VEGRTLPDEGTDTIVERADPTWPTTFFVSRIPSSGAFSSVYDWMDKWGANHTSTGYSHIG
ADVLTLAAMLRIPVSMHNIETKDIFRPRTWSSSEPSSNRRARDTDRRVRPS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggtctcagcatcggtgaggaccgaaatccggctgacaagcagcacagcgatgctgac
aagcgtgaacagctggagtattcggtcaagatggtgctggttgcccgagacctcatgaac
ggcaatttgcgtctggccgacatgggattcaaggaagaggccggtggttacgacgccatc
gccgccggcttccagggcaagcgtcagtggactgatggcaagctgaacggcgacgtcatg
gaaaccctgctcaacaccagcttcgactcggatggactgcgtcagccccaggtctttgcc
accgagggagatgccctcaacgggatagcgatgctgctcggcagcctcctcactcagcgt
cctcagttctttagcgatgtccgtacctattggagcccggaggccgttcgccgcgtcacc
ggtcatgagctgaccggtcgtgccgctggtggtttcgtcgatttcaggaattccggcgcg
agcactctcaacgcgacagaatgcgaggccgaggcggacggcactcccgtcatcaagcac
tggtgggatctcaccgaggacgacatccaggccgatctcgctgcgacgaccttccactcg
gcgacccaggagtacttcccgggcggcggattctcgacccacttcacgacggtgggggac
acgacggtgacagcggttcgtatgaacatggtcgctggagttggaccgaccctgcagatt
gtcgagggacggacgctcccggacgaggggacagacaccatcgttgagcgggcggacccg
acgtggccgacaacgttcttcgtgtcgcgcattccctcgagcggagccttcagtagcgtt
tatgactggatggataagtggggagctaaccacacctcgacggggtacagccatatcggc
gctgacgttctcaccctggcagccatgctgcgcatcccggtctcgatgcacaacattgag
accaaggacatcttccgtccgcgtacctggtcctcgtcggaaccgtcgtcgaaccgccgt
gcgagggataccgaccgacgagtgaggccctcatga

DBGET integrated database retrieval system