KEGG   Cutibacterium acnes KPA171202: PPA0693Help
Entry
PPA0693           CDS       T00188                                 

Definition
(GenBank) dihydrolipoamide acyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00020  Citrate cycle (TCA cycle)
pac00310  Lysine degradation
pac01100  Metabolic pathways
pac01110  Biosynthesis of secondary metabolites
pac01120  Microbial metabolism in diverse environments
pac01130  Biosynthesis of antibiotics
pac01200  Carbon metabolism
Module
pac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pac_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPA0693
  Amino acid metabolism
   00310 Lysine degradation
    PPA0693
Enzymes [BR:pac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PPA0693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AAT82450
UniProt: Q6A9W6
Position
complement(765084..766457)
Genome map
AA seq 457 aa AA seqDB search
MSTEVTLPALGESVTEGTVSRWLKAVGDTVEADEPLLEVSTDKVDTEVPSPASGTLLEIK
VPEDEDAEVGAVLAIIGDPSESGSAPAKPTAEPAEKAKPEPVKSEAEEAPAPAAPKPAEA
PKPAGTNEVAPRATNPSSDVYVTPLVRKLARENNVDLSTITGTGVGGRIRKQDVLAAAGK
SGEAPSAPQAPAAAPAPAAPKPAGSARKASQEVSPEAAALRGTTEKMSRLRKVIASRMVE
SLQISAQLTATVEVDMTAISRIRNAEKAAFKAREGVGLSYLPFITKAVVEALKANPTFNA
NIDTEAGTITYGSSENIGIAVDTPRGLLVPVIKNAGDLNIAGLAHQIGDLAARTRDNKVT
PDELSGGTFTITNYGSAGALFDTPIVNQPEVAILGTGALVKRPVVVTNEFGEDTIAVRDM
MYLSLSYDHRLIDGAVAARFLSGIKARLEEGDFAGEF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgaagtcactcttcctgcactgggcgagtccgtcaccgaaggcaccgtgtcc
cgctggctcaaggctgtcggagacaccgtcgaggccgacgaacccttacttgaggtgtcc
accgacaaggtcgataccgaagtcccctcccccgcctccggcaccctacttgagatcaag
gtccccgaagacgaagacgccgaagtcggcgccgtcctagccatcatcggcgacccctcc
gagtcgggctctgcgcctgctaagccgacggctgagcccgcggaaaaggccaaacctgag
ccggtgaagagcgaggccgaggaggcaccggcgccggccgcgccgaagcccgccgaggct
cccaaacccgccgggaccaatgaggtcgccccacgcgccaccaatccgtcgtcggacgtc
tacgtcaccccgctagtccgcaagctcgcccgggagaacaacgtcgacctgtcgacgatc
accggaactggtgtcgggggtcgtattcgcaagcaagacgtactagctgcagccggtaag
tctggagaagctccctcagctcctcaggcaccggctgccgcccctgccccggctgctccg
aaaccggctggttcagcccgtaaagcctcccaggaagtctctccggaagctgccgctctg
cgcggcaccaccgagaagatgagccgtctacgcaaggtcatcgcctcgcggatggttgag
tccctgcagatctcggctcagttgacggccaccgtcgaggtggacatgaccgctatctcc
cgcatccgcaacgctgagaaggctgctttcaaggcccgcgagggagtcggtctgtcctac
ttgcctttcattaccaaggccgtcgttgaagccctcaaggccaatccgaccttcaacgca
aatatcgacaccgaggcggggacgattacctacggttcttctgagaacatcggcatcgcc
gttgataccccgcgcgggctgctggttccggtcatcaagaacgctggtgatctcaatatc
gctgggctggcccaccagattggcgatctcgctgcccgcacccgcgacaacaaggtgacc
cctgacgagctgtccggcggcaccttcaccatcaccaactatggctcggctggagccctc
ttcgacaccccgatcgtcaaccagcccgaggtcgccatcctcggcaccggtgctctggtt
aagcgcccggtcgtcgtcaccaacgagttcggcgaggataccatcgcagtccgcgacatg
atgtacctctcgctgtcctacgatcaccggctcattgacggcgctgtggcggctcgcttc
ctatcgggcatcaaggctcgtctggaggagggcgacttcgccggagagttctga

DBGET integrated database retrieval system