KEGG   Propionibacterium acnes KPA171202: PPA0730Help
Entry
PPA0730           CDS       T00188                                 

Definition
guanyl-specific ribonuclease Sa3 precursor (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
pac  Propionibacterium acnes KPA171202
Brite
Enzymes [BR:pac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     PPA0730
Transfer RNA biogenesis [BR:pac03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    PPA0730
 Prokaryotic Type
    PPA0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
802024..802467
Genome map
AA seq 147 aa AA seqDB search
MTVATWFRSHRWSVWIVTLLAAVVVGCSTPGNVAAAGSNATTAPMTVMATTQSSVGLATI
QENELPTQARQTLKLIDSGGPFPFSRDGIVYHNNSGALPHHKDGWYHEYTAATPGAQGRG
PRRIVCGSDSTCFWTLDHYSTFKRIVR
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgcaacctggttccggtctcaccggtggtccgtctggattgtgaccttgcta
gcagctgtcgtcgtaggctgttcaacgcccggtaatgtagctgcggcaggctcgaacgct
accacggcccccatgaccgtcatggccaccacacagtcgtctgttgggttggccaccatc
caggaaaacgagctgcctacccaggctcggcagactctcaagctcattgactccggtggg
cccttcccattcagtcgggacggaattgtctaccacaacaacagtggcgcactacctcat
cacaaggacggctggtaccacgagtacaccgccgccactcctggagcgcagggtcgagga
ccgcgtcgcatcgtgtgcggttcagactctacctgtttttggacgttggaccattactca
acgtttaagaggatcgtccgatga

DBGET integrated database retrieval system