KEGG   Propionibacterium acnes KPA171202: PPA0753Help
Entry
PPA0753           CDS       T00188                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pac00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pac00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
827149..828648
Genome map
AA seq 499 aa AA seqDB search
MASFDSCRANDNGPAITGITLDSRQVRPGDLYVGLHGLHAHGASFAASAVESGAVAVLTD
EDGATLAAEAGVPIIVVDDPRAAMAVAAAKIFGRPSDAMTMFGITGTNGKTTTAFLVEAG
LRAAGHHVGTIGTIGFRLDGEELPSARTTVTTPESPDLEGLFAAMAERGASDVVMEVSSH
ALALQRVDGTCFDVVAFTNLGRDHLDFHNTLDNYFNAKARLFTPDLARVGVINVDDPRGR
QLVERMQANGVKAVTTSIHQPSDYQVTSWQAARAGAIFDVSTPSGERTLELSLPGEFNVR
NAAMALAMLEAAGLAFDDVADGLCSAQVPGRMERVDLADDAPTALVDFAHTPQAIASALD
AARSSVDGGRLIAVLGAGGDRDVAKRGPMGQIAAERADIVIVTDDNPRTEDPAVIRAAVL
EGAHEAAGDGVIVIDGGRRREAINEALRMAEAGDVICVLGKGHETGQNIGSEVLPFDDRE
VIRAEWKIMARQSEEDQAR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtggcctccttcgacagctgccgagctaatgacaacggtcctgcgatcaccgggatcaca
ttggactcccgccaggttcgcccgggcgatctctacgtcggtctgcacggcctgcatgct
cacggggcgagtttcgctgcctctgctgttgagtcgggtgcagtggcagtgctcaccgac
gaggacggtgccacactggcggcggaggcgggtgtgccgatcatcgtcgtcgacgatccg
cgcgctgccatggctgttgcggccgctaagatctttggacgcccctcggatgccatgacg
atgtttggtattacggggactaacggtaaaaccacaacggccttcctcgtggaggccgga
ttgcgtgcggctggccaccatgttgggactatcgggacaattggattccggctcgacggt
gaggagttgcctagtgctcgcaccaccgtcacgacgccggagtccccagatctggaaggg
ctattcgcggcgatggctgagcgaggtgcttctgacgtcgtgatggaggtgtcgtcgcac
gctctggccttgcagcgggtggatggaacctgtttcgatgtcgtggctttcaccaacctg
ggccgtgaccatctggatttccataacacccttgataattatttcaacgctaaagcccgt
ttgttcacccccgatctggctcgggttggcgttatcaatgtcgatgacccgcgtggtcgt
cagctagttgagcgtatgcaagccaacggggttaaggccgtgacaacgtcaatccatcag
ccctctgactatcaggtgacgtcatggcaggccgcgcgtgccggggcaattttcgacgtg
agcactccgtcgggggagcgcaccctcgagctgtcgttgcccggcgaattcaatgtccgc
aacgcagctatggctctggccatgctcgaggctgccgggctcgcttttgacgatgttgca
gatggtttgtgttccgcgcaggtgcctggccgtatggagcgggtcgatctcgcagatgac
gccccgacggccctcgtggactttgcgcacactccgcaagcgattgcatcagctcttgat
gccgctcggtcgtcagtcgatggcggccgtcttatcgccgtgctcggtgctgggggagac
cgtgacgtggccaagcgtggtccaatgggccagattgccgctgagcgtgccgatatcgtc
atcgttactgatgacaacccacgtaccgaagatcctgcggtgatccgtgcagccgtgctg
gagggggcccatgaagctgctggtgacggggtcattgtgatcgacgggggacgtcgtcgt
gaggcgattaacgaggccctgcggatggcggaggctggcgacgttatctgcgtgctcggc
aagggacatgagaccgggcagaacattggcagtgaggtgctgccgttcgacgatcgtgag
gttatccgggccgaatggaagatcatggcccggcagagcgaggaggatcaggcacgatga

DBGET integrated database retrieval system