KEGG   Cutibacterium acnes KPA171202: PPA0809Help
Entry
PPA0809           CDS       T00188                                 

Definition
(GenBank) putative phosphoglycerate mutase/fructose-2,6-bisphosphatase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00010  Glycolysis / Gluconeogenesis
pac00260  Glycine, serine and threonine metabolism
pac00680  Methane metabolism
pac01100  Metabolic pathways
pac01110  Biosynthesis of secondary metabolites
pac01120  Microbial metabolism in diverse environments
pac01130  Biosynthesis of antibiotics
pac01200  Carbon metabolism
pac01230  Biosynthesis of amino acids
Module
pac_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pac_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPA0809
  Energy metabolism
   00680 Methane metabolism
    PPA0809
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPA0809
Enzymes [BR:pac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PPA0809
Membrane trafficking [BR:pac04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PPA0809
Exosome [BR:pac04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PPA0809
  Exosomal proteins of melanoma cells
   PPA0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AAT82565
UniProt: Q6A9K1
Position
complement(889710..890456)
Genome map
AA seq 248 aa AA seqDB search
MHLLLIRHGQSENNAFATQSVETYQQGRKPDPELTELGRRQAQALGKWIGSVSPRPTKLY
ASPMMRTIQTADPVAEALDLPIIINDLIFERPGPVQIVDGVETGHPGSPRSALSAITDRA
VFPESITEEGWREARIETASEAADRAGRIAKWIRDTHNDDECIAIVAHGAIGSMMLLHLI
APQLAAGLRNHSIGSEPHWIGLQNTATSMIELHPDGYEVHWINRVDHLIEAGMVHGAVAA
STGNPGTR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcttctcctcatccgccacggccagtccgagaacaatgccttcgctacgcagtct
gtcgagacttaccagcagggtcgcaagcctgacccggagctcaccgagcttggacgacgt
caagctcaggccctagggaagtggatcggatcggtctctcctcggccaacgaagctgtat
gcctcccccatgatgcgtaccatccagacggctgacccggtcgctgaggcccttgatctt
cctatcatcatcaatgacctcatcttcgagcgtccaggtccagttcagatcgttgacggc
gtcgaaaccggtcatccaggatcgccgcgatcagctttgtcggccatcacagaccgtgct
gttttccccgagtccatcaccgaggaagggtggcgcgaagctcgcatcgagaccgcctcc
gaggctgctgaccgcgccggcagaatcgccaagtggatccgcgatacccacaatgatgac
gagtgcatcgcgatcgtcgctcacggcgcgatcggatccatgatgttgctgcatctcatc
gccccacaacttgccgctggtctgcgaaaccactccatcggcagcgaaccgcactggatc
gggcttcagaacaccgccacctcgatgatcgagttgcacccggacgggtacgaagttcat
tggatcaatcgcgtggatcaccttatcgaagccggtatggttcacggcgccgtcgccgca
tccaccggcaaccccggtacccgctga

DBGET integrated database retrieval system