KEGG   Propionibacterium acnes KPA171202: PPA0809Help
Entry
PPA0809           CDS       T00188                                 

Definition
(RefSeq) phosphoglycerate mutase/fructose-2,6-bisphosphatase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPA0809
   01230 Biosynthesis of amino acids
    PPA0809
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPA0809
  Energy metabolism
   00680 Methane metabolism
    PPA0809
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPA0809
Enzymes [BR:pac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PPA0809
Exosome [BR:pac04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PPA0809
  Exosomal proteins of melanoma cells
   PPA0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(889710..890456)
Genome map
AA seq 248 aa AA seqDB search
MHLLLIRHGQSENNAFATQSVETYQQGRKPDPELTELGRRQAQALGKWIGSVSPRPTKLY
ASPMMRTIQTADPVAEALDLPIIINDLIFERPGPVQIVDGVETGHPGSPRSALSAITDRA
VFPESITEEGWREARIETASEAADRAGRIAKWIRDTHNDDECIAIVAHGAIGSMMLLHLI
APQLAAGLRNHSIGSEPHWIGLQNTATSMIELHPDGYEVHWINRVDHLIEAGMVHGAVAA
STGNPGTR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcttctcctcatccgccacggccagtccgagaacaatgccttcgctacgcagtct
gtcgagacttaccagcagggtcgcaagcctgacccggagctcaccgagcttggacgacgt
caagctcaggccctagggaagtggatcggatcggtctctcctcggccaacgaagctgtat
gcctcccccatgatgcgtaccatccagacggctgacccggtcgctgaggcccttgatctt
cctatcatcatcaatgacctcatcttcgagcgtccaggtccagttcagatcgttgacggc
gtcgaaaccggtcatccaggatcgccgcgatcagctttgtcggccatcacagaccgtgct
gttttccccgagtccatcaccgaggaagggtggcgcgaagctcgcatcgagaccgcctcc
gaggctgctgaccgcgccggcagaatcgccaagtggatccgcgatacccacaatgatgac
gagtgcatcgcgatcgtcgctcacggcgcgatcggatccatgatgttgctgcatctcatc
gccccacaacttgccgctggtctgcgaaaccactccatcggcagcgaaccgcactggatc
gggcttcagaacaccgccacctcgatgatcgagttgcacccggacgggtacgaagttcat
tggatcaatcgcgtggatcaccttatcgaagccggtatggttcacggcgccgtcgccgca
tccaccggcaaccccggtacccgctga

DBGET integrated database retrieval system