KEGG   Propionibacterium acnes KPA171202: PPA0834Help
Entry
PPA0834           CDS       T00188                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pac01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pac00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
915250..916485
Genome map
AA seq 411 aa AA seqDB search
MTCAESRGAPVLPKRSGSRAVTDQRGAICGAATLVVKVGSSSLTLPGGGIDVRRVDDLVD
ALSEVIAVGRRVVLVSSGAIATGFPAMGITHRPRTLAGKQAAASVGQGILLAHYASRFAS
HGLRVGQVLLTVNDLVRPTSYRNAWSTLDTLLGLGVVPIVNENDTVATGEIRFGDNDRLA
ALVAELVRAQALILLSDVDALYTAHPDSPDARRVEVVEDIDTLDVDTHKAGSGVGTGGMT
TKLEAARMATCAGVPVVLAAAVDAPDVLAGVPVGTYFRPLATRRPRRLLWLADAATPQGQ
IVIDDGAVEALTQRHSSLLAVGVTRVHGDFQAGDPVTILASDGRVVGRGIAQFSHDEVRV
MRGRSSAWLAAEMGPAASREIIHRDAMVLSRRRKAEPSSRNQKSSGSRVTS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
gtgacctgcgcggagagtcgtggcgcgcccgtgttgccgaagaggagtggttcgagggcc
gtgactgatcagcgcggagccatatgcggggccgccaccctggtggtcaaggtcggatct
tcctctttgactcttcctggtggcgggattgacgttcgtcgtgttgacgacctggttgat
gcgctgagtgaggtcatcgcggtcggccggcgcgtcgtcctggtgagttccggggcgatt
gccaccggatttcccgccatggggataactcatcgtccgcgcactttggctggcaagcaa
gcggccgcgtcggtgggacaaggtattttactggctcactacgcgtcgaggtttgccagt
cacgggttgcgggtggggcaggtactactcaccgtcaatgacctggtgcggcccacctcg
taccgcaatgcctggtcaaccctcgacactttgctggggttgggcgtcgtgccgatcgtc
aacgagaacgacacggtcgccaccggagaaattcggtttggcgataatgatcggcttgct
gccctggtagccgagctggtgcgcgctcaagccctcatcctgctctctgacgttgacgcc
ttgtacaccgcccatccggattcaccggatgctcgtcgcgtggaggttgtggaggacatc
gacacattggatgtcgatacccataaagctggttcgggggtgggaaccggcggcatgacc
acgaaacttgaagccgcccgaatggccacctgtgccggggtaccggtggtactcgcagcg
gcggtggatgccccggacgttctggctggtgtccccgtgggtacctacttccgcccgctg
gcgacgcgacggccccgacggttgctgtggttggccgacgctgccaccccgcagggacag
atcgtcatcgacgacggagctgtcgaagctttgacacagcgtcattcctcgttgttggcg
gtgggtgtgactcgggtacacggggatttccaagcaggcgacccagtgacgatcctggcc
tccgacggtcgagttgttggtcgcggtatcgcccagttctcccatgatgaggtgcgcgtc
atgaggggacgttcgagtgcctggctggccgcagaaatgggtccggcggcctctcgcgag
atcatccaccgcgatgccatggtgctgagtcgtcgtcgtaaagctgagccgtcgtcgagg
aaccagaaaagtagcgggtcaagggtgacgtcctga

DBGET integrated database retrieval system