KEGG   Propionibacterium acnes KPA171202: PPA0910Help
Entry
PPA0910           CDS       T00188                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPA0910
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPA0910
   00620 Pyruvate metabolism
    PPA0910
   00640 Propanoate metabolism
    PPA0910
  Energy metabolism
   00680 Methane metabolism
    PPA0910
Enzymes [BR:pac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PPA0910
Lipid biosynthesis proteins [BR:pac01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PPA0910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
991632..991817
Genome map
AA seq 61 aa AA seqDB search
MVGDGTCPITDTWWQTETGMFQITTVPSMPLKPGAAGRPVAVVDEEGNEVPAGKEGFLVP
K
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggtgacggcacgtgtccgatcaccgatacctggtggcagaccgaaactggcatg
ttccagatcaccactgtgccgtcgatgccgctcaaaccaggtgccgctgggcgtccggtt
gctgttgtcgacgaggagggcaatgaggtccctgcgggcaaagagggcttcctcgtcccc
aagtga

DBGET integrated database retrieval system