KEGG   Cutibacterium acnes KPA171202: PPA0910Help
Entry
PPA0910           CDS       T00188                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00010  Glycolysis / Gluconeogenesis
pac00620  Pyruvate metabolism
pac00640  Propanoate metabolism
pac00680  Methane metabolism
pac01100  Metabolic pathways
pac01110  Biosynthesis of secondary metabolites
pac01120  Microbial metabolism in diverse environments
pac01130  Biosynthesis of antibiotics
pac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPA0910
   00620 Pyruvate metabolism
    PPA0910
   00640 Propanoate metabolism
    PPA0910
  Energy metabolism
   00680 Methane metabolism
    PPA0910
Enzymes [BR:pac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PPA0910
Lipid biosynthesis proteins [BR:pac01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PPA0910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: AAT82663
UniProt: Q6A9A3
Position
991632..991817
Genome map
AA seq 61 aa AA seqDB search
MVGDGTCPITDTWWQTETGMFQITTVPSMPLKPGAAGRPVAVVDEEGNEVPAGKEGFLVP
K
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggtgacggcacgtgtccgatcaccgatacctggtggcagaccgaaactggcatg
ttccagatcaccactgtgccgtcgatgccgctcaaaccaggtgccgctgggcgtccggtt
gctgttgtcgacgaggagggcaatgaggtccctgcgggcaaagagggcttcctcgtcccc
aagtga

DBGET integrated database retrieval system