KEGG   Propionibacterium acnes KPA171202: PPA0997Help
Entry
PPA0997           CDS       T00188                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pac00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pac00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1079597..1080541
Genome map
AA seq 314 aa AA seqDB search
MSTEVVEEFDADYTGRHFLSVEDMSSDDVMRIIERGRQFKAGDAPRVEPGHVAINMFFEN
STRTMTSFQMAEHRLGMKILDFDPGHSSVTKGESLYDSVRTVDAIGAEVAVIRHSTNHYY
DYLLATGMLGLSVVNGGDGSGQHPSQCMLDLMTIAEEFGHVDGLTVAISGDIVHSRVARS
DAQILTRLGANVVFTGPREWMDHDVTRLGTMATLDEVIADVDVAMMLRVQHERFDAGPDF
SATDYLHTFGLTDERAERMKPHAIIMHPAPVNRGCEISGHLVEAPSSRIFEQMGNGVMVR
MAILEQVLHGRETK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaggttgttgaagagttcgacgccgactacaccggacgtcactttttgtcg
gtcgaagatatgtccagtgatgacgtcatgcggatcatcgagcgtggtcggcaattcaag
gccggtgacgctccgcgcgtggagccgggtcacgtcgctatcaacatgttcttcgagaac
tccacccgaacgatgaccagctttcagatggctgagcaccgtctcggcatgaagatcctc
gacttcgatccgggccactccagcgtcaccaagggggagagcctctacgactcggtgcgc
accgtcgacgccattggcgccgaggttgccgtcatacgtcactccaccaaccactactac
gattacctgctcgcaaccgggatgctcggcctgtcggtcgtcaatggtggggatggatct
ggtcaacaccctagtcagtgcatgctggacctcatgactatcgctgaggagtttggccat
gtcgacggtctaacggttgcgatcagcggcgatatcgtgcactcgcgagtagctcgttct
gatgctcaaatccttaccaggcttggggccaacgttgtctttactggaccgcgtgagtgg
atggaccatgacgtcacccgacttggcacgatggcgactctcgacgaggtcattgctgat
gtcgacgtcgcgatgatgctacgcgtccagcacgagagattcgatgctggcccagacttc
tctgcaactgattacttacatacgtttgggctcacagacgagcgcgcagagcgaatgaag
cctcatgcgatcatcatgcacccggctcctgtaaaccgaggatgtgaaatttccggtcac
ctcgtagaggctccctcgtctcgtatttttgagcagatggggaacggagttatggtgcga
atggctattttggaacaggtgttgcacggcagggagacaaaatga

DBGET integrated database retrieval system