KEGG   Propionibacterium acnes KPA171202: PPA1015Help
Entry
PPA1015           CDS       T00188                                 

Definition
aldose-1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPA1015
   00052 Galactose metabolism
    PPA1015
Enzymes [BR:pac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PPA1015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1098644..1099543)
Genome map
AA seq 299 aa AA seqDB search
MINDAILPTGTQYEISHGPWQAIVTEQGATLRSLHYEGTDVIKSFDADQSPTSSQGQQLL
PWPNRIRDGHYTFDGMEQQLAVSEVDRHNAIHGLVAWSRWSLVEHTDTSVTQTIRIMARP
GWPGTISVRLTHRLSDAGLAVEVTARNVGTTAVPFGYAAHPYLCLGGTIDDWTVDAPFTS
WLQVDDRLLPMQMREMDSIHTLNGLTVGQRTFDTAYTVKGDGTVGSPAWRIRVSNGETSH
ELWGDAAMSWVQIYTPDDRHSLAVEPMTCGPDAFNEGPTHGDVIRLEPGNDVTLHWGIA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatgacgccatactccccaccggcacccagtatgagatctcccatggcccttgg
caggccatcgtcacggagcagggcgccacccttcgcagccttcactatgagggaacagac
gtcatcaaatccttcgatgctgatcagtcgccgacctcatctcagggccaacagctcctt
ccttggcccaaccgcatccgtgacggtcactacaccttcgacggtatggagcagcagctg
gccgtgagcgaggtcgatcgccacaacgctattcacggtctagtggcatggtctcgctgg
tctttagtggaacataccgacacatcggtgactcaaacgatccgaatcatggctcgtcct
ggttggcctggaaccatcagcgtgcgccttacccaccgcttaagcgacgccggtctagct
gttgaagtcaccgcgcgcaatgtcggtacgacagcggtgccgtttggatacgcagcacac
ccctatctctgcctgggtggcaccatcgacgactggacagtcgacgccccgtttacctcg
tggttacaggtcgatgatcggctgctaccaatgcagatgcgcgagatggatagcatccac
acgctgaacggtctcacggtcggacagcgcaccttcgataccgcttacaccgtgaaaggc
gacggaaccgtcggatcgcccgcatggcgtatccgggtctccaacggtgaaacgagccac
gaattgtggggcgacgccgcgatgagctgggtgcaaatctacactccagacgaccgccac
agtctggccgtcgaaccaatgacctgcggcccagacgcatttaatgagggcccgacccac
ggtgacgtcattcgactagagcccggtaatgacgtcacactgcactggggcatcgcctga

DBGET integrated database retrieval system