KEGG   Propionibacterium acnes KPA171202: PPA1131Help
Entry
PPA1131           CDS       T00188                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pac01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pac00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pac00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1227369..1228625
Genome map
AA seq 418 aa AA seqDB search
MSARDLPDARGHFDRFGGRFVPEALQAALSQLTGTFEAAVTDPDFLTELEDLRREYAGRP
SPLTEAPRFSQYIFQQTGHQVRVLLKREDLNHTGSHKINNVLGQALLTRKMGKRRLIAET
GAGQHGVATATVAAMMGMECRIYMGQIDTERQALNVARMQLLGAEVIAVEAGSRTLKDAM
NEAMRDWVAHVEDTHYLIGTASGPHPFPKLVREFQRVISAEARQQCLDRVGRLPDAICAC
VGGGSNAIGSFAEFIDDPEVRLYGFEAGGDGVETGRHAASITRGSVGVLHGTRTYILQDP
DGQTMESHSISAGLDYPGVGPEHSWLAARKRATYLPVNDREAMEALRTLTRTEGIMPAIE
SAHAVAGVLKIAKDLPAHDGEPSVVIVTVSGRGDKDVDTALEWFAMDGSVDATTGGME
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcacgagacttgcccgacgctcggggacacttcgaccgtttcggtggccgattc
gttccagaagctctccaagctgctcttagccagcttacggggaccttcgaggccgcggta
accgatcctgactttctcactgagctggaggatctgcgccgggagtacgccggacgcccc
tctccgcttacagaggcaccgcgattttctcaatacatctttcaacagaccggtcatcag
gtgcgagtccttctgaagcgcgaggacctgaaccacaccggttctcacaagatcaacaat
gtgttgggccaagccctgctgactcgaaagatgggcaagcgccgtctcattgcggagacg
ggagctggacagcatggcgtggcgacggcaaccgtggccgcgatgatgggcatggagtgc
cggatctatatgggccagatcgacactgagcgtcaggccctcaatgtggctcgcatgcag
ctgttgggcgccgaggtcattgcagtggaagccggctcgcgcacgttgaaggacgccatg
aacgaggccatgcgagattgggtggcccatgttgaggacacccactacctcatcggtacc
gcttctgggccacacccgttccctaaactggtgcgagagtttcagcgggtcatttctgcg
gaggcccgtcagcagtgccttgatcgggttggacgccttcccgacgccatttgtgcgtgt
gtcggtggtgggtcgaatgccatcggatcgttcgccgagttcatcgacgaccccgaggtt
cgtctctacggtttcgaggcgggcggtgacggtgtcgagaccggtcgccatgcagcatcg
atcaccaggggttccgttggtgtactgcacggcactcgcacctacattctgcaagatccg
gacggccagacgatggaatctcactccatatcggccggcctggactatcccggagttggc
cccgaacattcttggttagcggcccggaagcgtgctacttacctcccggtcaacgaccgc
gaggccatggaggctctacgtaccctcacccgcaccgaaggcatcatgccggccattgag
tcggcccacgctgtcgccggcgttcttaagatcgcgaaagacctgcctgctcacgacggc
gagccgtcagtggtcatcgtcacggtgtcgggtcgcggggataaagatgttgacactgcc
ctggagtggtttgccatggacggcagcgtcgacgccactacgggaggtatggaatga

DBGET integrated database retrieval system