KEGG   Propionibacterium acnes KPA171202: PPA1132Help
Entry
PPA1132           CDS       T00188                                 

Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PPA1132
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPA1132
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPA1132
Enzymes [BR:pac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PPA1132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1228622..1229119
Genome map
AA seq 165 aa AA seqDB search
MTGSASVYLRAHQENRPALVGYFPVGHPSVPHSIDAMKALTTGTTGTGVDLVVIGMPYSD
PMMDGTVIQHVTTGALERGVRTRDTLLATEAVAGTGTPCVIMTYWNLVEHYGVDAYARDL
ASAGGSGLTTPDEAEDRGDSVTVGIDRMCAIVDDLAAGVRRAERQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtagcgccagtgtctacctcagggcccaccaagagaaccgcccggccctcgtc
ggttacttcccggtgggacacccgtcagttcctcactcgatcgatgctatgaaggcactg
actacgggcactactgggaccggtgtcgacctcgtcgtgatcggaatgccttactccgac
ccgatgatggacggcaccgtcattcagcacgtcactaccggggctctagagcgcggggta
cgcactcgcgacaccctattggccacagaggccgtggccgggaccggaactccgtgcgtg
attatgacctattggaaccttgtcgagcactacggtgtcgacgcttatgctcgcgatctg
gcatccgcgggtggctcagggctcaccacccccgatgaggctgaggatcggggggactca
gtgacggtaggaattgaccggatgtgcgccatcgtcgacgacctggcggccggagtacgg
cgggcggaacgccagtga

DBGET integrated database retrieval system