KEGG   Propionibacterium acnes KPA171202: PPA1159Help
Entry
PPA1159           CDS       T00188                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PPA1159
Enzymes [BR:pac01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PPA1159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1259658..1260263
Genome map
AA seq 201 aa AA seqDB search
MISHFSGTVSAAGPTWVVLDNHGVGIKVLCPPATAASARINQDMSLHTSLVVREESLTLY
GFVEADDRDAFELVQTASGVGPKLAAAIMSVLDAAQLATAITEEDDATLCRVPGIGRKGA
AKMILELKDKVAALAPRGASASGATHVAAPWREQVAEGLVGLGWSTKDAEKAVDKVVALK
EADPAMSIGNLMRAALRSLAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcccatttttccggcacggtaagtgctgccggcccgacttgggtcgtccttgac
aatcatggggtcggtatcaaggtgctatgccctcctgccacagctgcgagtgctcgcatc
aaccaagatatgtccctgcacacttccctggttgtgagagaggagtccctgactctttac
gggttcgtcgaagctgatgatcgcgatgcttttgagctggtgcaaaccgcgtcgggagtc
ggtcccaaattagctgcagcgattatgagtgtccttgatgctgctcagctagccacggcg
attaccgaagaagatgacgcaactctatgccgcgttcccggtattggtcgcaaaggtgcg
gcgaaaatgatcctggagctcaaggacaaggtcgcagcccttgccccacgcggagcttcg
gcgagcggagcaacccatgtggccgcaccgtggcgggaacaggtggcggaagggctggtc
ggcttgggctggtcgactaaagacgcggagaaggccgtcgacaaggtggttgctctcaag
gaagccgatccagctatgagcatcggcaacctcatgcgagcggcgttgcgtagtttggcg
cggtga

DBGET integrated database retrieval system