KEGG   Propionibacterium acnes KPA171202: PPA1159Help
Entry
PPA1159           CDS       T00188                                 

Definition
(GenBank) holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PPA1159
Enzymes [BR:pac01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PPA1159
DNA repair and recombination proteins [BR:pac03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PPA1159
    RecFOR pathway proteins
     PPA1159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1259658..1260263
Genome map
AA seq 201 aa AA seqDB search
MISHFSGTVSAAGPTWVVLDNHGVGIKVLCPPATAASARINQDMSLHTSLVVREESLTLY
GFVEADDRDAFELVQTASGVGPKLAAAIMSVLDAAQLATAITEEDDATLCRVPGIGRKGA
AKMILELKDKVAALAPRGASASGATHVAAPWREQVAEGLVGLGWSTKDAEKAVDKVVALK
EADPAMSIGNLMRAALRSLAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcccatttttccggcacggtaagtgctgccggcccgacttgggtcgtccttgac
aatcatggggtcggtatcaaggtgctatgccctcctgccacagctgcgagtgctcgcatc
aaccaagatatgtccctgcacacttccctggttgtgagagaggagtccctgactctttac
gggttcgtcgaagctgatgatcgcgatgcttttgagctggtgcaaaccgcgtcgggagtc
ggtcccaaattagctgcagcgattatgagtgtccttgatgctgctcagctagccacggcg
attaccgaagaagatgacgcaactctatgccgcgttcccggtattggtcgcaaaggtgcg
gcgaaaatgatcctggagctcaaggacaaggtcgcagcccttgccccacgcggagcttcg
gcgagcggagcaacccatgtggccgcaccgtggcgggaacaggtggcggaagggctggtc
ggcttgggctggtcgactaaagacgcggagaaggccgtcgacaaggtggttgctctcaag
gaagccgatccagctatgagcatcggcaacctcatgcgagcggcgttgcgtagtttggcg
cggtga

DBGET integrated database retrieval system