KEGG   Cutibacterium acnes KPA171202: PPA1181Help
Entry
PPA1181           CDS       T00188                                 

Definition
(GenBank) shikimate 5-dehydrogenase
  KO
K00014  shikimate dehydrogenase [EC:1.1.1.25]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pac01100  Metabolic pathways
pac01110  Biosynthesis of secondary metabolites
pac01130  Biosynthesis of antibiotics
pac01230  Biosynthesis of amino acids
Module
pac_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPA1181
Enzymes [BR:pac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     PPA1181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_dh_N Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AAT82930
UniProt: Q6A8I5
Position
1288376..1289182
Genome map
AA seq 268 aa AA seqDB search
MRCAVIGHPVAHSLSPAIHRAAYQVLGLEWSYQAIDVEPGGLRAFIEGLDGSWRGLSVTM
PHKADLVELGETDATVDMLGAANTWVCRDGTTIVRNTDVTGAEAALRARGVTDVEKVVML
GAGATARSVLAAAIGMGAGEAVVMSRSRERSTKILKLADGLGIRVAWLPFESEPPRCNLI
VSTVPAGSLIRRAEDLAARANAVFDVVYDPWPTPLAVAGKIAGATVIDGLDLLAGQAVGQ
VQLMTGYPVPMDVLRSTAQNGLAEHARL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgtgcggtgattggccatccagtggctcactccttgtccccggcaattcaccgc
gccgcataccaggtcctcggcctggagtggtcctaccaggccatcgacgtcgagcctggt
ggtttgcgtgcttttattgaggggctcgacggttcctggcgagggctatcagtgacgatg
cctcacaaggccgatctcgtcgagttgggggagaccgacgcgacggttgacatgttggga
gcggcgaatacctgggtttgtcgtgacggcacgaccatcgtccgcaataccgacgtcacg
ggggcagaggctgcgcttcgtgccaggggagtgactgatgtcgagaaggttgtcatgctg
ggggcgggcgcaacagcccggtctgttcttgcggctgccattgggatgggagcgggcgaa
gccgtcgtgatgtcgcgctcgcgcgaacggtccacgaagatccttaaacttgctgatggc
ctcggcattcgtgttgcctggttgcctttcgaatcggagcctccgcggtgcaacctcata
gtctcgacggttccagccggttccttgataaggcgtgctgaagatctcgctgctcgagct
aatgcggtttttgacgtcgtctatgatccctggccaacccctttggccgtggctgggaag
atcgctggtgcaaccgtcattgacggcttggacctgctcgctgggcaggcggtcggtcag
gtgcaactcatgactggctacccggtgccgatggacgttttgaggtccacagcgcagaac
ggcctggctgagcacgcccgcctttga

DBGET integrated database retrieval system