KEGG   Propionibacterium acnes KPA171202: PPA1190Help
Entry
PPA1190           CDS       T00188                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pac00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1296314..1296913
Genome map
AA seq 199 aa AA seqDB search
MSSVPVIPQARGLRHTGPVTVAVVSGPTAVGKGTVVGALLRSHPEIVVSRSVTTRPPRPT
ERDGIDYDFITPEQFDKLVDGEGLLEWATVHNSHRYGTPRGPVERAVADNRTVVLEIDLQ
GARQVRETYPQATQIFLAPPSWEELVHRLIGRGTETPEQQKQRLETAKVELANADEFDAV
VVNDTVDHAVAHLVELLSL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtccccgtcatccctcaggcccgagggcttcgtcacaccggcccggtcacc
gtggctgtcgtctccggacctaccgcagttggtaaagggaccgtggtaggggcgctgctg
cgtagccatccggagatcgtcgtttccaggtcggtgactacccgtccgccgcgccccact
gaacgcgatgggatcgattacgacttcatcacccctgagcagttcgacaagctcgttgac
ggcgagggtctccttgagtgggcaaccgtccataacagccaccggtacggcacaccgcgc
ggtcctgttgaacgggcagttgctgacaatcgcacggtcgtgctggaaatcgatctgcag
ggagctcgccaagttcgcgaaacctatcctcaggcgacccagatcttcctcgcgccaccc
tcatgggaggagctagtccaccgtctgatcggtcgcggcacggaaacaccagagcaacag
aagcagcgtctggagactgcaaaggttgagctggccaacgcggatgaatttgacgccgtt
gtcgtcaacgacaccgtagatcacgcagttgcgcatctggtagaattactaagtctgtga

DBGET integrated database retrieval system