KEGG   Propionibacterium acnes KPA171202: PPA1257Help
Entry
PPA1257           CDS       T00188                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pac01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pac00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:pac00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1360591..1361661)
Genome map
AA seq 356 aa AA seqDB search
MSQQNRLFGVIETYRDRLPMDGIDQIVTLGEGATPLVPAPRLGAELDATVWVKVEGANPT
GSFKDRGMTMAMTKALADGSKAVVCASTGNTSASASAYASRAGMTPVVLLPQGKIAAGKL
AQAVVHGGRIIQILGNFDDCLRIARELAENFPVSLVNSINPYRIEGQKTAAFEVVDVLGD
APDIHALPVGNAGNITAYWKGYREYVADGPASHTPRMFGFQAAGAAPLVLGHDVNDPETV
ATAIRIGRPASGKLALAARDESEGLIDAVTDEQILDAQTFLAAREGIFVEPASAVGVAGL
FKLKSEGRLDPGLRIVVTVTGNGLKDIDTALSRTTLSTEAVEASTDQVAALLDFCS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcagaatcgtctcttcggcgtgattgagacctatcgagaccgtctccctatg
gacggaattgaccagatcgtgacgttgggggagggggcgaccccgttggtgcctgcccca
cgattgggcgccgagcttgacgcgacggtatgggttaaagttgaaggggccaatccgacc
ggatcgttcaaggatcgtggcatgacgatggccatgacgaaagcccttgccgacggctcg
aaagccgtggtgtgtgcctctaccggtaatacctctgcctcggcatcggcttacgcctcc
cgagccggcatgactccggtcgtgctccttccccagggcaagattgcagctggcaaactc
gcccaggctgttgtccatggcggtcgaatcatccagattctcggcaacttcgacgattgc
ctgcgtattgcccgcgagctggccgagaatttcccggtctccctggtgaactcgatcaat
ccgtaccgcatcgagggacagaaaactgctgcctttgaggtcgttgacgttcttggtgac
gctcctgatatccacgctcttccggtgggcaacgcaggcaatatcaccgcctattggaag
ggttaccgcgagtacgtagcggacggtcctgccagccacacgccgcggatgttcggattc
caagccgctggcgcagcccccctggtgctgggccacgacgttaatgacccggaaacggta
gccaccgctattcgtatcggtcgtccggcctccggcaagctggcgttggccgctcgagac
gagtcggaggggctcatcgacgctgtcacggacgagcaaattcttgacgcccagactttc
ctagctgctcgagagggcatttttgttgagccggcatcagcagtcggagtggcaggtttg
ttcaagttgaagtccgagggacgcctggatcctggactgcgcatcgtcgtcacggtaact
ggaaacggtctgaaggacattgacactgcattgagtcgcactaccttgtcaaccgaggct
gtggaagcttcgactgaccaggttgccgctttgttggacttctgttcctga

DBGET integrated database retrieval system