KEGG   Propionibacterium acnes KPA171202: PPA1317Help
Entry
PPA1317           CDS       T00188                                 

Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PPA1317
Enzymes [BR:pac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PPA1317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1428928..1430814
Genome map
AA seq 628 aa AA seqDB search
MTDLVPVAAGSRLEPFARAGVLEASDIHLANLVCRIGGETNCDVSLAIALSCRELRRGSV
FWDPHEIANVVRQQILDPAIPDIETSDQAALFAELEWPPPGEWLSTLEASPVIAGRDDPL
NRLPARLDDGLVYLEKYWQAEHDVARDLATLAADPPSQGPVSADDVVSSISNALAASGIM
LDPAQADAAIAAIMHRVSVLAGGPGTGKTTTVCALLAALQQADPHLGAVALAAPSGKAAA
RLRDSVSQVSERMPDDLKPIVADATTVHSLLKWQGPGTSFGYDEQHKLPFGVVVVDEASM
LSLPLAASLLSAIGPQTRLILVGDPGQLVSVDAGSVLADIVSSADALQAQLPVTILTCNH
RSRGDIARLSEAVREGDKSTALDVLATAAGVTHDSPSPDSIATISGRRSITWIDADPASI
TMADLPAVAEVIARTGARMLELAQASADAAALKLVDAHRLLCAHREGPYGVDEWSQRMVT
VLSDVLPGVGQGRWVLGETAIVTHNLAQLGVNNGDCGVIVETRPVPTIALPGPGGVPRRL
PCSLIPSLQPLQAMTIHKAQGSQFTDVTVVLPPPDSPLLSRELLYTAITRAREHLTVVGT
RESVERAIDRANDRRSGIQRRWEESRTS
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgactgacctcgtcccggtagcagcaggaagtcggctcgagcccttcgcccgagccgga
gtcctcgaggccagcgacatccatttagccaatctagtgtgccgcatcggtggcgagacc
aactgcgatgtcagcctcgccatcgctttatcatgccgtgagcttcggcgcgggtccgtg
ttctgggacccacatgaaatcgcaaacgtcgtccgccagcaaatccttgatccggcaatt
ccagacatcgaaaccagcgaccaggcagccctattcgcggaattggaatggccacctcca
ggcgagtggctgtccacgctagaggccagtcccgtcattgctggccgtgatgatccgctc
aaccggttgccggctcggcttgatgatggcctggtctacctagagaaatattggcaagct
gagcatgatgtcgcccgcgatctcgctaccctcgctgcggatccgccaagccaaggccca
gtgtcggccgacgatgttgtttccagcatcagtaatgccttagcagcatccggaattatg
ttggatccagctcaagctgatgctgccatcgccgcaattatgcaccgagttagtgtgctt
gcaggtggccccggaaccggcaagacaactacggtatgcgccctcctagctgccttgcaa
caggctgaccctcatcttggagccgtggcccttgcggctcccagcggcaaagcagcggca
cgcttgcgtgactcagtttcgcaagtttcagagcgaatgcccgatgacctgaaaccgatt
gttgctgacgcaactaccgtccactcactgctgaaatggcaggggccgggaacctcattc
ggatatgacgagcaacacaagcttccgttcggagtcgtcgtcgttgacgaagcatcaatg
ctttctctgcctctggccgctagcctcctctctgcaatcgggcctcaaactcgtctaatt
ctcgtcggggacccagggcagcttgtctcggtggacgccggtagtgtcctggccgacatc
gtttcgtcggctgatgccctccaagcgcagcttcctgtcacgatcctcacctgtaaccac
cgctcgagaggagatatcgcacggctgtcggaggcggtacgcgagggagacaagagcact
gcgttggacgtattggcgacagctgctggcgtgacacatgactctccttcccccgatagc
atcgcgacgatcagtggtcgtcgcagtattacgtggatcgacgctgacccggcgagtatc
accatggccgaccttccggcggtcgcggaggtgatcgcacgcaccggggcaagaatgctt
gagcttgctcaggctagtgccgacgctgctgctctcaaactcgtcgatgcccaccggttg
ttgtgcgctcaccgagaggggccatacggggtagacgagtggtctcagcgcatggttact
gtactttcagatgtgttgcctggtgttggccaaggccggtgggttctcggcgaaactgca
atagtaacgcataacctcgcacaattgggagtcaataacggcgattgcggggtcatcgtt
gaaacaaggcccgtccccacgatagctctaccgggacccggtggagtccccagacggttg
ccctgttccctcatcccatcgctgcaacccttacaggcgatgacgattcacaaagcgcag
ggcagccaattcacggacgtaacggtggtcctgccaccacccgactcgcccctcctctct
cgtgagttgctctataccgccatcacgcgtgcacgtgaacacctcactgtggtgggcaca
agggagtctgtggagagggcgattgaccgggctaatgatcgacgttctgggattcagcgc
cggtgggaagaaagtcgcacttcctga

DBGET integrated database retrieval system