KEGG   Propionibacterium acnes KPA171202: PPA1367Help
Entry
PPA1367           CDS       T00188                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pac00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1489808..1491097
Genome map
AA seq 429 aa AA seqDB search
MTSTYSVVDLIRAKREGQTLNSDQIAWLIRAYTDDIVADEQMSAMAMAVYFQGLDDAELS
AWTTAMIKSGERMSFAGLSRPTVDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGH
TGGTLDKMEAIPGWRADLSHDEMVAQLEKVGAVICAAGPGLAPADKKLYALRDVTGTVES
IPLIASSIMSKKIAEGTDSLVLDVKTGSGAFMKTDKDARELASRLVELGEAAGVRTTALL
THMDVPLGYACGNGIEVAESLEVLAGGGPADVVELTVALARHMVKVAGLDGIDPADVLAS
GQAMDVWRNMVRAQGGDPDAPLPMAHHTQDIVATEAGVITGIDAMSVGLAAWRLGAGRAR
KEDPVQAAAGIMLRVRPGDRVVTGQPLATLLTDTPDSIARAEDAMTNAFTVGQTFQPQDI
VIDTVVAQS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcacctattccgtcgtcgaccttatccgcgctaagcgcgaaggccagactctc
aactccgaccaaatcgcatggcttatccgcgcctacaccgacgacatcgtcgccgacgag
cagatgtctgccatggcgatggcggtgtacttccaggggctcgacgacgctgagctgtca
gcctggacgacggccatgatcaagtcgggcgagcggatgtccttcgctgggctgtcccgc
cccactgtcgacaagcactccactggcggcgtgggcgacaaaattaccttgccgctggct
cccctggtggccgcgtgcggtgctgccgtcccacagctgtctgggcgtggcctgggccac
accggaggcaccctcgacaagatggaggccattcccggatggcgggcggatctctctcat
gacgagatggtcgcccagctcgagaaagtcggcgccgtcatctgcgcagcgggcccggga
ctagcccctgctgacaagaagctctacgccctgcgcgacgttaccggcaccgtcgagtcc
atcccgctgatcgcttcgtccatcatgagcaagaagatcgcagagggcaccgacagcctc
gtcctcgatgtcaagaccggctcgggtgccttcatgaagacagataaggacgcccgcgaa
ctcgccagccgtctcgtcgagctaggtgaagccgccggggtgcgtaccaccgccctactg
acccacatggacgtcccactgggttacgcctgcggtaacggcatcgaggttgccgaatcc
ctcgaagtgttagccggcggaggtcctgccgacgtcgtcgagctcaccgtcgccctggcc
cgtcacatggtgaaggtggctggattggacggcatcgacccggccgatgtactcgccagt
ggccaggcaatggatgtctggcgcaacatggttcgtgcccagggcggcgaccctgacgct
ccactaccgatggcccaccacacccaggacatcgtcgccaccgaggctggcgtcatcacc
gggattgatgccatgtccgttggcctagctgcctggcgtttgggtgccggacgcgcccgc
aaagaggatccggtgcaagctgcggctggcatcatgttaagagttcgccccggcgaccgc
gttgtcacaggccagccattggccaccctgctcaccgacacccccgactccattgcgcgg
gccgaggatgccatgaccaacgcgttcaccgtcgggcaaaccttccagccgcaagacatt
gtcatcgacaccgtcgtagcccagtcgtga

DBGET integrated database retrieval system