KEGG   Propionibacterium acnes KPA171202: PPA1683Help
Entry
PPA1683           CDS       T00188                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PPA1683
Enzymes [BR:pac01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PPA1683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1835077..1837185)
Genome map
AA seq 702 aa AA seqDB search
MSLTDPHLTTLADHFGIARDYYDWKGQYTEVGEATVIAVLDGLGIDASTPERAERACHEV
TNRKWRRVLPGIVVLREGQEGRVDVHVNAGEWVEVHVVCEDGQHRECWQVDNWNPDRHVD
DRWIGEATFGIPGDLPLGYHTIVATTADHRATSTLVVSPNWLGLPRSMGSSRVWGHAVQL
YSTRSRASWGMGDFSDLADLSTWAATQGADYVLVNPLHASQVVSPIEPSPYLPCSRLFLN
PLYVRPEIIPEYADLDVYERSQARSARAQAAADVEAIDRDRSWNAKLPVLEAVHALGLEG
SRELSYQAFRRLRGTRLGDLATWCALTEVYGNDWRTWPEEYQRPSNRAVSEFVRAHEERV
DFFMWLQWIADQQLSAAQSAGRDAGMSLGLMCDMAVGVSGAGADAWMLGKLFADGVCVGS
PPDAFNQAGQEWGQPPMRPDILADLAYRPFRDMVRAALRHAGGIRIDHILGLFRLWWVPV
GLGPRMGTYIRYDHEAMVGILALEAHRAGALVVGEDLGTVEPWVRAYLRERGIMGTSVLW
FENGENGNPLPPEQWREYAMSSVATHDLPPTTGYLAGDHVEVRHELGLLTESLEHERAEV
ARQTATWIAILRERGVLVGDDPSEEDIVLAMHRMLTRTPSKVLNATLTDAVGDRRTQNLP
GTTNEYPNWRVPLSHPDGSPMWLEEVFTDERAARLSHVMNEK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgacagatccccacctgacgaccctggccgatcatttcggcatcgctcgtgat
tattacgactggaagggccagtacaccgaggtcggggaggcgactgttattgctgtcctt
gacggtttgggaattgacgcgtcgactccggaacgtgccgaacgcgcgtgccacgaggtg
actaaccggaagtggcgtcgagtgttgcccggaatcgtggtcctacgtgagggccaagag
gggcgggttgacgtccacgttaacgcaggggagtgggtggaggttcacgtcgtttgcgag
gacgggcaacaccgcgagtgttggcaggttgataattggaaccccgatcgccatgtggac
gatcgttggattggtgaggccaccttcggtatccctggcgatctaccgttgggctaccac
acgatcgtcgcgacgactgcggaccatcgcgcgacttctacgcttgttgtctccccgaac
tggctcggccttcctcgttcgatgggttcgtctcgggtctggggccatgccgtgcagttg
tattcgactcgctcccgcgcctcctggggaatgggcgatttttccgacctggcggacctg
tccacctgggcggccactcagggtgctgactacgtgctcgtgaatccgctgcatgccagc
caggttgtttcccctatcgagccgtcgccgtatttgccttgcagccgcctcttcctgaac
ccgctgtatgtgcgccccgagatcatcccggagtatgccgacctcgacgtctatgagcgt
tcccaggcacgctcggcccgggcccaagcagcggccgatgttgaggcgatcgatcgagat
cgttcctggaacgctaagctgccagtgctagaagccgtccatgcccttggcctggaggga
tcgagggaattgtcctaccaggcattccgccggctgcgcggtactcgtctaggagatctc
gcgacgtggtgtgcattgacggaggtatacggcaacgattggcgcacctggcccgaggag
tatcaacgccccagcaaccgtgccgtctcagagttcgtgcgagcccacgaggaacgcgtc
gactttttcatgtggctgcagtggattgctgaccaacagctttcggcggctcaatctgcc
ggacgtgatgccgggatgtcgctgggactcatgtgcgatatggcggtgggtgtttccggt
gccggagctgatgcgtggatgctcgggaagctctttgctgacggcgtttgcgtcgggtca
ccgcctgatgcttttaatcaggctgggcaggaatggggacagcctccgatgcgtcccgac
atcctcgccgatctggcatatcggcctttccgcgacatggtgcgcgccgctttgcgtcac
gctggtggtattcgcatcgaccatattctcggcctgttccggctgtggtgggtacccgtc
ggtctcggcccgcgtatgggtacttacatacggtacgaccacgaagccatggttggtatt
ttggcgctggaggcgcaccgggctggcgcccttgtcgtgggcgaggacctgggaacggta
gagccgtgggtgcgcgcctacctgcgtgagcgcggcatcatgggcacctcggtcctgtgg
ttcgagaacggtgagaatggcaatccgctgcctcctgagcagtggcgcgagtacgccatg
agttcggtcgctacccatgatctacctcccactactgggtatctggctggtgatcacgtt
gaggtgcgtcatgagctgggactactcacggaatctctcgagcacgagcgcgctgaggtg
gctcgtcagactgccacctggatcgccatcctgcgtgagcgtggcgtgttggtgggggat
gacccctccgaagaggacatcgtgttagcgatgcatcgcatgcttacccgcactccgtca
aaggtgctcaatgccaccctgactgacgcagtgggagatcgtcgcacccaaaacttgccg
ggtaccacgaatgaatatccaaactggcgggtccctctcagccatccggatggttccccg
atgtggctggaggaggtatttactgacgagcgggctgcgcgactgtctcacgtcatgaac
gagaagtga

DBGET integrated database retrieval system