KEGG   Propionibacterium acnes KPA171202: PPA1755Help
Entry
PPA1755           CDS       T00188                                 

Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00020  Citrate cycle (TCA cycle)
pac00640  Propanoate metabolism
pac00660  C5-Branched dibasic acid metabolism
pac01100  Metabolic pathways
pac01110  Biosynthesis of secondary metabolites
pac01120  Microbial metabolism in diverse environments
pac01130  Biosynthesis of antibiotics
pac01200  Carbon metabolism
Module
pac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pac_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPA1755
   00640 Propanoate metabolism
    PPA1755
   00660 C5-Branched dibasic acid metabolism
    PPA1755
Enzymes [BR:pac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PPA1755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA GARS_A ATP-grasp SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: AAT83484
UniProt: Q6A6Y0
Position
complement(1916405..1917580)
Genome map
AA seq 391 aa AA seqDB search
MDLYEYQARDLFEKHGVPVLRGIVAETPEQASEAAAKLGTPVVAVKAQVKVGGRGKAGGV
KIAKSAAEAAERAEAILGMDIKGHTVHKVMVAEGADIAEEYYFSILLDRGERRYLAMCSR
EGGMDIETLAKERPEALAKVPVDPIDGVDDAKAREILSEAGFPDSEQDAIVPAVLKLWET
YRDEDATLVEVNPMIKTGDGRILAIDGKMTVDNNASFRQPDHAGLVDRATTDPLELRAGE
LGLNYVKLDGNVGVIGNGAGLVMSTLDCVAYAGENFPGSPAPANFLDIGGGASAEIMANG
LDLIMSDEQVRSVFVNVFGGITACDQVALGIKGALEKLGDKAVKPLVVRLDGNAVAEGRK
ILEEFNYPLVTMVSTMDEAASKAAELASKEA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtatgaataccaagcccgcgacctgtttgagaagcacggcgtgcccgtactt
cgaggcatcgtcgcggagactccagagcaggcgtccgaggctgcagcgaagctcggtacc
cccgtcgtcgccgtcaaggcgcaggtcaaagtgggtggccgtggcaaggctggcggtgta
aagatcgctaagtccgcggccgaggcggctgaacgcgccgaggccatcctcggtatggac
atcaagggtcacaccgttcacaaggtgatggtcgctgaaggtgctgacattgccgaggaa
tactacttctcgatcttgctcgaccgtggagagcgtcgctaccttgcgatgtgctcgcgt
gagggtggcatggacatcgagacccttgctaaggagcgccccgaggctctcgccaaggtg
ccggtcgacccgattgacggcgttgacgatgctaaagcccgcgagatccttagcgaggca
gggttccccgactctgagcaggacgctatcgtcccggctgttctcaagctgtgggagacc
taccgtgacgaggatgccaccctcgtcgaagtcaacccgatgatcaagaccggcgatgga
cgcatcctggctatcgacggcaagatgactgttgacaacaacgcgtccttccgtcagcct
gaccatgccggcctggtggatcgcgccaccaccgacccgctcgagttgcgtgccggcgag
ctcggtctcaactacgtcaagctcgacggcaacgtcggcgtcatcggaaacggtgctgga
ctggttatgagcacccttgactgcgttgcttacgccggtgagaacttcccgggatctccg
gctcccgctaacttcctcgacatcggtggcggcgcctcggccgagatcatggccaacggc
cttgacctcatcatgagtgacgagcaggtgcgttccgtgttcgtcaacgtctttggcggt
atcaccgcctgtgaccaggtggcgcttggtatcaagggcgctctcgagaagttgggcgac
aaggccgtgaagccgctcgtcgtccgtctggacggcaacgctgtggccgagggccgcaag
attctcgaggaattcaactacccgctcgtgaccatggtctcgaccatggacgaggccgcc
agcaaggccgccgagctcgcatccaaggaggcctga

DBGET integrated database retrieval system