KEGG   Propionibacterium acnes KPA171202: PPA2057Help
Entry
PPA2057           CDS       T00188                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PPA2057
  Lipid metabolism
   00561 Glycerolipid metabolism
    PPA2057
   00600 Sphingolipid metabolism
    PPA2057
Enzymes [BR:pac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PPA2057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2235065..2236876
Genome map
AA seq 603 aa AA seqDB search
MASHLSDTLHGRTTVHNDGKLPVHLTAVSIMCASLLSGAELDDLDILIAPSAWMAEQRWT
HHRLSDLLVDVGTELHGESPRDRFVLSSESGWSSGRWEPVGFITDPASGRAVGWQIEHNG
GWTVELARRSSTLGLCLFGPTDLQHHWMHQLNPGETFTTPAVTLVVSDNSWQGAAAELST
YRRVLRGNNGTAAPIVFNDYMNTLMADPTAERLSTLIPAAARTGAEVYCIDAGWHSDDTD
WWDDVGRWEPSPRRFPGGLRHTLDLIVAYGMTPGLWIEPLAVGLRSPLVNDLPPEAFMRR
AGVPIVEQNRVRLDMRNPQARAHLDTVIDRMVSYGIGYLKIDDNFSVGSGPDEDADSPGD
GLLGHCRAWAAWLADLPRRHPGLVVENCASGGMTTDYALLARAAIQSTSDLQDSVRYPPI
AANSPMTILPEQAANWAYPQPDMDDEEIVFTVTTSLAGTFYLSGHVDRMNAHQMALVQSG
AEVAKALRSDLTSQIPWWPKGLAGWDDEWVVTGRRKKSSRDGVIIVWHRPSTESTVLDLP
DLAGTHLEPLYPPASLVPDPGIHIADSSGSPRLSCPSPKPTGRVFRVRDLHDCVTDVAEM
EKK
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
gtggcatcccacctcagcgacaccttgcacgggcgaacaaccgtacataatgacggcaag
ctcccagtccatctcactgccgtctctatcatgtgcgccagtctgctgtcaggagccgaa
ctcgatgacctcgatatactcatcgcacccagcgcatggatggccgaacaacggtggacc
catcaccgcctgtccgatcttctggtggacgtcggcaccgaattgcatggagaatccccg
cgcgaccgcttcgtcctatcctcagagtccggttggtcttcaggacgttgggaaccggtc
ggcttcattaccgacccggcctctggacgcgccgtcggctggcagatcgagcacaacggt
ggctggactgtcgaattagcccggcgctcttcaaccctcggcctctgcctcttcgggccg
accgaccttcagcaccactggatgcaccagctcaaccctggcgagactttcactaccccc
gcggtgacgttagtggtatccgataacagctggcagggcgcggcagccgaactaagcacc
taccgccgtgtattgaggggcaacaatggcacagcagctccgatcgtcttcaacgactac
atgaacaccctcatggccgaccctacggccgagcgactctcgaccctcatcccggccgca
gctcgcaccggagccgaggtgtactgcatcgacgccggatggcactccgacgacacagac
tggtgggacgacgtcggccgctgggagccctcgccccgccgatttcccggcgggctgcgc
cacacccttgatctcatcgtcgcctacggcatgacgcccggcctgtggattgagccgctg
gcggttggtctgcgcagtcctctcgtcaatgatctacccccggaggctttcatgcgccgc
gcaggggttccgatcgtcgaacagaatcgggtgcgtctagatatgcgcaatccgcaagct
cgcgctcatctagataccgtcatcgaccggatggtcagttacggcatcggctacctcaaa
attgatgacaatttctctgtcggttctggccccgacgaggacgcggattctcctggggac
ggtttgctggggcactgccgcgcttgggccgcctggcttgccgacctccctcgacgtcac
cctggacttgtcgttgagaactgtgcatctgggggcatgaccaccgactacgccctgttg
gcccgagcagccatccagtcgacatcagacctccaggattcggtgcgttacccgcccatc
gccgccaattcaccgatgacgattttgcccgaacaagccgccaattgggcttacccacag
ccagacatggacgacgaggaaatcgtctttaccgtcacgacctccttggccggcaccttt
tacttgtccggtcatgtcgaccgcatgaacgcccaccagatggctctcgtgcaatccggc
gcagaggtagccaaggccttacggtcagatctgaccagccaaataccgtggtggccgaaa
ggccttgccggctgggacgacgagtgggtcgtcaccgggcgtcgaaaaaagtcctctcgc
gacggggtgatcattgtctggcaccgtcctagcaccgaatcgacggttctcgacttacct
gacctggctgggacccacctcgaacccctttacccacctgcctccctggtccccgaccca
ggaattcacattgctgactcatcgggttcacctcggctgagttgtccgtctcccaaacca
accggccgggtcttccgcgtccgggaccttcacgattgcgtcaccgatgtcgcagaaatg
gagaagaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system