KEGG   Cutibacterium acnes KPA171202: PPA2057Help
Entry
PPA2057           CDS       T00188                                 

Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00052  Galactose metabolism
pac00561  Glycerolipid metabolism
pac00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PPA2057
  Lipid metabolism
   00561 Glycerolipid metabolism
    PPA2057
   00600 Sphingolipid metabolism
    PPA2057
Enzymes [BR:pac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PPA2057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase RexA
Motif
Other DBs
NCBI-ProteinID: AAT83770
UniProt: Q6A643
Position
2235065..2236876
Genome map
AA seq 603 aa AA seqDB search
MASHLSDTLHGRTTVHNDGKLPVHLTAVSIMCASLLSGAELDDLDILIAPSAWMAEQRWT
HHRLSDLLVDVGTELHGESPRDRFVLSSESGWSSGRWEPVGFITDPASGRAVGWQIEHNG
GWTVELARRSSTLGLCLFGPTDLQHHWMHQLNPGETFTTPAVTLVVSDNSWQGAAAELST
YRRVLRGNNGTAAPIVFNDYMNTLMADPTAERLSTLIPAAARTGAEVYCIDAGWHSDDTD
WWDDVGRWEPSPRRFPGGLRHTLDLIVAYGMTPGLWIEPLAVGLRSPLVNDLPPEAFMRR
AGVPIVEQNRVRLDMRNPQARAHLDTVIDRMVSYGIGYLKIDDNFSVGSGPDEDADSPGD
GLLGHCRAWAAWLADLPRRHPGLVVENCASGGMTTDYALLARAAIQSTSDLQDSVRYPPI
AANSPMTILPEQAANWAYPQPDMDDEEIVFTVTTSLAGTFYLSGHVDRMNAHQMALVQSG
AEVAKALRSDLTSQIPWWPKGLAGWDDEWVVTGRRKKSSRDGVIIVWHRPSTESTVLDLP
DLAGTHLEPLYPPASLVPDPGIHIADSSGSPRLSCPSPKPTGRVFRVRDLHDCVTDVAEM
EKK
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
gtggcatcccacctcagcgacaccttgcacgggcgaacaaccgtacataatgacggcaag
ctcccagtccatctcactgccgtctctatcatgtgcgccagtctgctgtcaggagccgaa
ctcgatgacctcgatatactcatcgcacccagcgcatggatggccgaacaacggtggacc
catcaccgcctgtccgatcttctggtggacgtcggcaccgaattgcatggagaatccccg
cgcgaccgcttcgtcctatcctcagagtccggttggtcttcaggacgttgggaaccggtc
ggcttcattaccgacccggcctctggacgcgccgtcggctggcagatcgagcacaacggt
ggctggactgtcgaattagcccggcgctcttcaaccctcggcctctgcctcttcgggccg
accgaccttcagcaccactggatgcaccagctcaaccctggcgagactttcactaccccc
gcggtgacgttagtggtatccgataacagctggcagggcgcggcagccgaactaagcacc
taccgccgtgtattgaggggcaacaatggcacagcagctccgatcgtcttcaacgactac
atgaacaccctcatggccgaccctacggccgagcgactctcgaccctcatcccggccgca
gctcgcaccggagccgaggtgtactgcatcgacgccggatggcactccgacgacacagac
tggtgggacgacgtcggccgctgggagccctcgccccgccgatttcccggcgggctgcgc
cacacccttgatctcatcgtcgcctacggcatgacgcccggcctgtggattgagccgctg
gcggttggtctgcgcagtcctctcgtcaatgatctacccccggaggctttcatgcgccgc
gcaggggttccgatcgtcgaacagaatcgggtgcgtctagatatgcgcaatccgcaagct
cgcgctcatctagataccgtcatcgaccggatggtcagttacggcatcggctacctcaaa
attgatgacaatttctctgtcggttctggccccgacgaggacgcggattctcctggggac
ggtttgctggggcactgccgcgcttgggccgcctggcttgccgacctccctcgacgtcac
cctggacttgtcgttgagaactgtgcatctgggggcatgaccaccgactacgccctgttg
gcccgagcagccatccagtcgacatcagacctccaggattcggtgcgttacccgcccatc
gccgccaattcaccgatgacgattttgcccgaacaagccgccaattgggcttacccacag
ccagacatggacgacgaggaaatcgtctttaccgtcacgacctccttggccggcaccttt
tacttgtccggtcatgtcgaccgcatgaacgcccaccagatggctctcgtgcaatccggc
gcagaggtagccaaggccttacggtcagatctgaccagccaaataccgtggtggccgaaa
ggccttgccggctgggacgacgagtgggtcgtcaccgggcgtcgaaaaaagtcctctcgc
gacggggtgatcattgtctggcaccgtcctagcaccgaatcgacggttctcgacttacct
gacctggctgggacccacctcgaacccctttacccacctgcctccctggtccccgaccca
ggaattcacattgctgactcatcgggttcacctcggctgagttgtccgtctcccaaacca
accggccgggtcttccgcgtccgggaccttcacgattgcgtcaccgatgtcgcagaaatg
gagaagaaatga

DBGET integrated database retrieval system