KEGG   Propionibacterium acnes KPA171202: PPA2092Help
Entry
PPA2092           CDS       T00188                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00010  Glycolysis / Gluconeogenesis
pac00020  Citrate cycle (TCA cycle)
pac00620  Pyruvate metabolism
pac01100  Metabolic pathways
pac01110  Biosynthesis of secondary metabolites
pac01120  Microbial metabolism in diverse environments
pac01130  Biosynthesis of antibiotics
pac01200  Carbon metabolism
Module
pac_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPA2092
   00020 Citrate cycle (TCA cycle)
    PPA2092
   00620 Pyruvate metabolism
    PPA2092
Enzymes [BR:pac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PPA2092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 GCV_H HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AAT83800
UniProt: Q6A613
Position
complement(2266523..2267932)
Genome map
AA seq 469 aa AA seqDB search
MKNYCMPDPGEGLTEGEVVSWQVSPGDTVKINDVLCEVETAKSIVELPSPFAGTVAKLCA
EPGETVAVGTPLVTIDDGSEDEPEFLVGHVTAEPGRRRRRRRGAAVSTERAREEGADTHP
EQSVSESRHDAEAKPEQRLTEPAPRQDPPRMDRTAHILAKPPARRLAADLGVDLSQVTGT
GPQGAVTRSDVKAAAHHGAAAAGDGGACPGDAELASLSVMSRRLLGGAPTEPDGHTRKVP
VRGVRKVTAKAVKDSLDTKALVTAFLTCDVTPTMELVNRLRADRRFKGLRVSPLTVWCKA
VCLAMGRTPIINAAWDDAADQIVFRDHINLGIAAATPRGLMVPVVRDAQDMAMLELATEI
TRIVAIAKEDKLQPPDYADGTFSITNVGVFGLDAGTPVVNRTESAILVLGALARRPWVVG
TGDDERVVPRWVTTMSLGFDHRLIDGEQGSTFLHDVAEILSDPASAMLY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactactgcatgcccgacccgggcgaaggacttactgagggagaagttgtctcc
tggcaggtgtctcccggcgacaccgtcaagatcaacgatgtgctgtgcgaggtcgagacc
gctaaatcgatcgttgagcttcccagcccgtttgccggaaccgtggcaaaactgtgcgct
gagcctggtgagacggtggccgttggaacgcccttggtgacgattgacgacggttcggag
gacgagccggagtttctcgttggtcacgttacagcggagcccgggcgtcgacgtcgtcgc
cgcaggggtgctgcggtgtcgactgagcgggcgcgcgaggagggtgcagacactcatcct
gagcaatcggtttcggaatctcggcacgacgccgaggcgaaaccggagcagcgtctgacc
gagccggctcctcgtcaagacccaccgcgcatggaccgcaccgcgcacattcttgccaag
ccgccggcccgacgattggcagcagacctcggcgtcgacttgtctcaggtgaccggcacc
ggtccgcagggtgcagtgacgaggagtgacgtcaaagcggccgctcatcatggcgctgct
gcagccggggacggcggtgcttgtcctggcgacgccgagctggcgagcctgtcggtgatg
tctcgacgtctcctcggtggcgccccgaccgagcccgacggccacacccgcaaggtgcca
gtgcgtggggtgcgcaaggtcacagcgaaggccgtgaaggattccttggatacgaaggcc
ctcgtgacggccttccttacctgcgacgtcaccccgacgatggagctggtcaaccggctg
cgtgccgaccgtcgtttcaaaggcctgcgtgtctccccgctgacggtgtggtgcaaggcg
gtgtgcctggcgatggggcgcacccccatcatcaacgccgcatgggatgacgccgctgac
cagatcgtcttccgtgaccacatcaacctcggcattgccgccgccacgcctcgcggcctt
atggtgccggtggtgcgcgacgcccaggacatggcgatgcttgagttggcgacggagatc
acccggatcgttgcgatcgccaaggaagacaaactgcaaccgcccgactatgccgacggt
accttctcgatcacgaacgtcggggtgttcgggctcgatgccggtactcccgtggtcaac
cggacagagtcagcgatcctcgtgctcggtgctctcgctcggcggccgtgggtcgtcggg
accggtgatgacgagcgcgttgtgcccaggtgggtgacgacgatgagcctcgggttcgat
catcgtcttattgacggtgagcagggttcgacattcctccacgacgttgcggagatcctc
tctgacccggcgtcggcaatgctgtactga

DBGET integrated database retrieval system