KEGG   Propionibacterium acnes KPA171202: PPA2092Help
Entry
PPA2092           CDS       T00188                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:pac01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pac00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pac00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pac00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2266523..2267932)
Genome map
AA seq 469 aa AA seqDB search
MKNYCMPDPGEGLTEGEVVSWQVSPGDTVKINDVLCEVETAKSIVELPSPFAGTVAKLCA
EPGETVAVGTPLVTIDDGSEDEPEFLVGHVTAEPGRRRRRRRGAAVSTERAREEGADTHP
EQSVSESRHDAEAKPEQRLTEPAPRQDPPRMDRTAHILAKPPARRLAADLGVDLSQVTGT
GPQGAVTRSDVKAAAHHGAAAAGDGGACPGDAELASLSVMSRRLLGGAPTEPDGHTRKVP
VRGVRKVTAKAVKDSLDTKALVTAFLTCDVTPTMELVNRLRADRRFKGLRVSPLTVWCKA
VCLAMGRTPIINAAWDDAADQIVFRDHINLGIAAATPRGLMVPVVRDAQDMAMLELATEI
TRIVAIAKEDKLQPPDYADGTFSITNVGVFGLDAGTPVVNRTESAILVLGALARRPWVVG
TGDDERVVPRWVTTMSLGFDHRLIDGEQGSTFLHDVAEILSDPASAMLY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactactgcatgcccgacccgggcgaaggacttactgagggagaagttgtctcc
tggcaggtgtctcccggcgacaccgtcaagatcaacgatgtgctgtgcgaggtcgagacc
gctaaatcgatcgttgagcttcccagcccgtttgccggaaccgtggcaaaactgtgcgct
gagcctggtgagacggtggccgttggaacgcccttggtgacgattgacgacggttcggag
gacgagccggagtttctcgttggtcacgttacagcggagcccgggcgtcgacgtcgtcgc
cgcaggggtgctgcggtgtcgactgagcgggcgcgcgaggagggtgcagacactcatcct
gagcaatcggtttcggaatctcggcacgacgccgaggcgaaaccggagcagcgtctgacc
gagccggctcctcgtcaagacccaccgcgcatggaccgcaccgcgcacattcttgccaag
ccgccggcccgacgattggcagcagacctcggcgtcgacttgtctcaggtgaccggcacc
ggtccgcagggtgcagtgacgaggagtgacgtcaaagcggccgctcatcatggcgctgct
gcagccggggacggcggtgcttgtcctggcgacgccgagctggcgagcctgtcggtgatg
tctcgacgtctcctcggtggcgccccgaccgagcccgacggccacacccgcaaggtgcca
gtgcgtggggtgcgcaaggtcacagcgaaggccgtgaaggattccttggatacgaaggcc
ctcgtgacggccttccttacctgcgacgtcaccccgacgatggagctggtcaaccggctg
cgtgccgaccgtcgtttcaaaggcctgcgtgtctccccgctgacggtgtggtgcaaggcg
gtgtgcctggcgatggggcgcacccccatcatcaacgccgcatgggatgacgccgctgac
cagatcgtcttccgtgaccacatcaacctcggcattgccgccgccacgcctcgcggcctt
atggtgccggtggtgcgcgacgcccaggacatggcgatgcttgagttggcgacggagatc
acccggatcgttgcgatcgccaaggaagacaaactgcaaccgcccgactatgccgacggt
accttctcgatcacgaacgtcggggtgttcgggctcgatgccggtactcccgtggtcaac
cggacagagtcagcgatcctcgtgctcggtgctctcgctcggcggccgtgggtcgtcggg
accggtgatgacgagcgcgttgtgcccaggtgggtgacgacgatgagcctcgggttcgat
catcgtcttattgacggtgagcagggttcgacattcctccacgacgttgcggagatcctc
tctgacccggcgtcggcaatgctgtactga

DBGET integrated database retrieval system