KEGG   Propionibacterium acnes KPA171202: PPA2164Help
Entry
PPA2164           CDS       T00188                                 

Definition
beta-N-acetylglucosaminidase precursor (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PPA2164
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PPA2164
Enzymes [BR:pac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PPA2164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2343607..2345577)
Genome map
AA seq 656 aa AA seqDB search
MRTDLLRLVSLSRWHNSRREHNMRRSTVKRRTVMAAAAGAFAASALPLSRAAADDTRSQL
ASMTLDQKIGQVLWTHVFGASADDASMARKNQLAFGDDVRTPAQAVQKYHLGGVLYFNWS
GNISTPTNPAAVAHLSNGLQEAARTSSTAPLAIAVDQEGGIVARITSPATEFPGNMALGA
VNDPRAARAQGAVLGRELAALGINVDFAPDVDVNTNPANPVIGVRSMGDDPVRVGVLGVE
QIRGIQSRGVAATAKHFPGHGDTQIDSHLGLPVVEYGRTTLERHLVPFRMAISAEVDMIM
TAHIIVKTLDPTMPATLSKKVLTGLLREQMGYRGIITTDALDMEGAQLAVMTEDEKGTYT
RLKAAADAEGNDPTAADEGHASAEFNAFMKPIRGRVAVQAFEAGSDILLNPHDADAVVTA
MRRAIADGRVSERRLDESVLRILSWKRRRCITGRPVDLAAADREVRSGRKVADDIAARSV
TMLVNDGTLPLKPSRVLVTGTRRGNPEYLVEPLRLAGFTPILVPSTGQEPTTADVEKAVT
VGVDAVIVVTHGLKRGDAQDAMVKALARTGNPVVEIMTGTPYDVAMTHCPHAALAVYSNR
KVSMVAAVAMMAGRNPVGRLPVRVPDPNGGTAFPRGFGLSYRATPGPYEGPGAKTA
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaccgacctgcttagactggtcagcctcagccgttggcacaactccagacgagaa
cacaacatgaggagaagtaccgtgaaacgacgcactgtcatggccgccgcggctggagcc
tttgcggcatcagcccttccgctgtcgcgagcggcagcggatgacacccggtctcagctc
gcctccatgaccttggaccagaagatcggtcaagtgctatggacccatgtcttcggtgcc
agcgctgacgacgcttcaatggcgaggaagaatcagctggcctttggcgatgacgtccgc
actccggcccaggccgtgcagaagtaccaccttggcggggtgctgtacttcaactggtcc
ggtaacatctcgacgcccacgaatccggccgccgtcgcccacctttccaacggcctgcaa
gaggcggcgaggacgtcgtcgacggcgccgttggccatcgctgtcgatcaggagggcggt
atcgtcgcgcggattacctccccggccaccgaatttccagggaatatggcgctgggtgct
gtcaatgacccgcgcgctgcgcgtgcccaaggcgcggtgctcggtcgcgagctggctgcc
ctgggcattaacgtggacttcgccccggacgttgacgtcaacactaacccagccaatccc
gtaatcggggtgaggtccatgggggacgatccggtgcgcgtcggggtactcggcgtcgag
cagattcgcggcattcaatccagaggggttgcggccaccgccaagcatttcccaggtcat
ggtgatacccagatcgactcccatcttggtcttccggtcgtggagtacggtcgcactacc
ctggagcgtcacctggtgcccttccgcatggcgatcagcgcggaagtggacatgatcatg
acagcccacatcatcgttaagaccttggacccgacgatgccggccaccctgtcgaagaaa
gtgcttactggcctgctgcgcgaacagatggggtatcgcggcatcatcaccaccgacgcc
ctggacatggagggcgcccagcttgcggtcatgaccgaggacgagaagggcacgtatacc
aggctcaaggctgctgccgacgccgagggcaatgaccccacggcggccgatgaggggcat
gcgagtgccgagttcaacgcctttatgaaaccgatccgggggcgtgttgcggtgcaggct
ttcgaagccggatccgacattttgctgaacccccatgacgctgatgccgtcgtcacagcg
atgcggagggctatcgcggacggtcgggttagcgagcggcgtctcgacgaatcggtgctg
cgcatcctctcttggaagcggcgtcgctgcattacgggcaggccggttgacctcgcggcg
gccgatcgtgaggtacgatctggccgcaaggttgctgacgacatcgctgccaggtcggtg
acgatgctggtcaatgacggcactctgccgctcaagccgtcacgggtgctcgtcaccgga
acacgtcggggtaatccggagtacctcgtcgagccgttgcgcttggccggattcaccccg
attcttgttccgtcaaccggacaggaaccgacgacagccgatgtcgagaaagcggtgact
gtcggtgttgatgccgtcatcgtggtcacgcacgggttgaaacgtggagatgcccaggac
gccatggttaaggctctggcgcggaccgggaatccggtcgtggagattatgacagggacc
ccgtacgacgtggcgatgactcattgcccgcatgccgcactagctgtctactccaaccgc
aaggtgagcatggttgcggctgtcgcgatgatggctggacgaaacccggtggggcgactt
ccggtacgggtgcccgacccgaacggaggcacagcttttccgcgcggtttcgggctcagc
taccgcgcgacgcccggaccctatgagggcccgggcgcgaagactgcttga

DBGET integrated database retrieval system