KEGG   Propionibacterium acnes KPA171202: PPA2304Help
Entry
PPA2304           CDS       T00188                                 

Definition
glycerol kinase 2 (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PPA2304
Enzymes [BR:pac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PPA2304
Exosome [BR:pac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPA2304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2502581..2504128)
Genome map
AA seq 515 aa AA seqDB search
MQIRKATNMSDEKFVLAIDEGTTSARAIIFNHAGQIMAVGQQEFEQIFPRAGWVEHDPIE
IWEAVRDVVGLALTKANINRHQLAAAGITNQRETAVVWDKNTGEPVYNAIVWQDTRTQKI
CNELAGDKGADRYKEICGLGLSTYFSGPKVKWILDNVEGARARAEAGDLLFGNMDTWVLW
NLTGGTNGGVHITDPTNASRTMLMDVRKLQWDDSMCEVMGIPKSMLPEIKSSSEIYGYGR
KNGLLIDTPISGILGDQQAATFGQACFQKGMAKNTYGTGCFMLMNTGEEAIFSENGLLTT
VCYKIGDQPTVYALEGSIAVAGSLVQWLRDNLKMFETAPQIEALANTVEDNGGAYFVPAF
SGLFAPYWRPDARGALVGLTRYVNRGHIARAVLESTAFQTREVLEAMNADSGVPLTELRV
DGGMTANETLMQFQADQVNVPVVRPVVAETTALGAAYAAGIAVGFWEGENDVTDNWAEDK
RWEPKMDKNERERLFRNWKKAVTKTFDWVDDDVKE
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgcagataagaaaggcaaccaacatgagcgatgagaagtttgtactcgccattgacgag
ggcactacttccgcccgtgccatcatctttaaccacgccggccagatcatggccgttggc
cagcaggagttcgagcagatcttcccgcgtgctggatgggttgagcatgacccgatcgag
atctgggaggccgttcgcgacgtcgttgggctcgccctgaccaaggccaacatcaaccgc
caccagctggctgctgctggtatcaccaaccagcgcgagaccgcagtggtgtgggacaag
aacaccggtgagccggtttataacgccatcgtgtggcaggacacgcgcactcaaaagatc
tgtaacgaactagctggtgacaagggcgccgaccgctacaaggagatctgtggtctgggc
ctgtcgacctatttctctggcccgaaggtcaaatggattctcgacaacgttgagggagcc
cgtgcgagggccgaggccggcgatctgctcttcggtaacatggacacttgggtgctgtgg
aacctgactggcggtactaacggtggcgtgcacatcaccgatccgaccaacgcgtcccga
accatgctcatggacgtccgaaagctgcagtgggacgactcgatgtgcgaggtcatgggg
attccgaagtccatgcttcctgagatcaagtcctcctccgagatctacggctatggtcgc
aagaacggcctgctgatcgataccccgatctccggcattcttggcgatcagcaggccgcc
acttttggccaggcttgcttccaaaagggcatggcgaagaacacgtacggcaccggctgc
ttcatgctcatgaacacaggtgaggaggccatcttctccgagaacggtctgctgaccacc
gtctgctacaagatcggtgaccagcccaccgtctatgccctggaaggttcgattgccgtc
gctggatcgctggtacagtggctgcgcgacaacctcaagatgttcgagaccgccccgcaa
atcgaagctctcgctaacaccgtcgaggacaatggtggcgcctactttgtgccggccttc
tctggcctgttcgcgccgtactggcgtccagacgcccgtggtgccctcgtgggcttgacc
cgctacgtcaaccgtggccacattgcccgcgccgtgctcgagtcaaccgccttccagact
cgcgaggttcttgaggctatgaacgccgactccggtgtgccgctgacggagctgcgcgtc
gacggtggcatgaccgccaacgaaaccctcatgcagttccaggccgaccaggtcaatgtg
ccggtggttcgccccgtggtcgccgaaaccaccgctctgggcgccgcctacgccgctggc
atcgctgtcggtttctgggaaggcgagaatgacgtcaccgacaactgggccgaggacaag
cgctgggaacccaagatggacaagaatgagcgcgaacgtctgttccgcaactggaagaag
gctgtcactaagaccttcgactgggtggacgacgacgtcaaggagtga

DBGET integrated database retrieval system