KEGG   Propionibacterium acnes C1: PAC1_00465Help
Entry
PAC1_00465        CDS       T02330                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pacc  Propionibacterium acnes C1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAC1_00465
   01230 Biosynthesis of amino acids
    PAC1_00465
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAC1_00465
   00030 Pentose phosphate pathway
    PAC1_00465
   00051 Fructose and mannose metabolism
    PAC1_00465
   00052 Galactose metabolism
    PAC1_00465
  Energy metabolism
   00680 Methane metabolism
    PAC1_00465
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PAC1_00465
Enzymes [BR:pacc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PAC1_00465
Protein phosphatases and associated proteins [BR:pacc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PAC1_00465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
102531..103763
Genome map
AA seq 410 aa AA seqDB search
MAVVTVTHMIATMDRSVVGAIHGRMGTTRHRSGVVMSKKKKVGILTAGGDCPGLNAAIRG
FGKAAIRQHDMELIGIQDGFLGLAGNRTISLDPRALSGILTVGGTILGTSRDKVNHMIID
GEERDMVPTIVENYEKLGLDALVTLGGGGTAKNAYKLAKAGLNVLHLPKTIDNDIVGTDD
SFGFSTALEIATEAIDRLHSTAHSHHRIILAEIMGHRAGWLALGSGIAGGADVILLPEVP
YKLDSIVQAVENRQKQGLNFSVIAVAEGARDEADSAAMAGAQALVDASKTSETKAAAKKA
KKDLEHSMRDNTLKLATQLEEATGLESRVSILGYVQRGGIPCAHDRLLATRLGTVGAKLV
DDGEFGIMVAAQGGDATTVPLKDVAGKVKYVPADHPWVKAARQVGTGLGD
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgtcacagtgacgcacatgattgccacaatggaccgcagtgttgtcggcgcc
atccatggaaggatgggtaccacccgacacagatcaggagtcgtcatgtccaaaaagaag
aaggtcggcatcctcaccgcaggcggtgattgccccgggctcaacgccgctatccgcgga
tttggcaaggctgccatccgccagcacgacatggagctcatcggtattcaggacggcttt
cttggattggcagggaaccgcaccatctcccttgacccgcgtgccctctcaggcatcttg
acggtcggcgggaccatcctgggaactagccgtgacaaggtcaatcacatgattatcgac
ggcgaggaacgggatatggtccccaccatcgtcgagaattacgagaagctgggacttgac
gctttggtgactttgggtggcggtggcaccgccaagaacgcgtacaagctcgctaaggcc
gggctgaacgtcctgcatctgcccaagacgattgacaacgacatcgtcggaaccgacgac
tccttcgggttctcgacagcactggagattgccacggaggccatcgaccggctgcactcc
accgcccattcccaccaccgcatcatcctcgctgagatcatgggccaccgtgccggctgg
ctggccctcggctcgggcatcgctggtggcgctgacgtcatcctgctgcccgaggtgccc
tacaagctggactccatcgtccaggcggtggaaaaccggcaaaagcaggggttgaatttc
tcggtcatcgcggtggctgagggagctcgcgatgaggctgattcggccgcgatggctgga
gctcaggccctcgttgacgcttccaagacctccgagacaaaggcggctgccaagaaggcc
aagaaggaccttgagcattccatgcgtgacaacaccctcaaattggctactcagcttgag
gaggccaccgggctggaatcgcgagtctcgatcctcggctatgtgcagcgcggtggtatc
ccgtgcgcccacgaccgtctgctcgcgaccaggctgggaaccgtgggtgccaagctcgtt
gacgacggcgagttcggcatcatggtcgccgctcagggcggagacgccacgaccgttccg
ttgaaagacgtcgctggcaaggttaaatacgtacctgccgaccacccatgggttaaggcg
gcccgacaggtcggaaccggtctaggcgactga

DBGET integrated database retrieval system