KEGG   Propionibacterium acnes C1: PAC1_00465Help
Entry
PAC1_00465        CDS       T02330                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
pacc  Propionibacterium acnes C1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAC1_00465
   00030 Pentose phosphate pathway
    PAC1_00465
   00051 Fructose and mannose metabolism
    PAC1_00465
   00052 Galactose metabolism
    PAC1_00465
  Energy metabolism
   00680 Methane metabolism
    PAC1_00465
Enzymes [BR:pacc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PAC1_00465
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     PAC1_00465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
102531..103763
Genome map
AA seq 410 aa AA seqDB search
MAVVTVTHMIATMDRSVVGAIHGRMGTTRHRSGVVMSKKKKVGILTAGGDCPGLNAAIRG
FGKAAIRQHDMELIGIQDGFLGLAGNRTISLDPRALSGILTVGGTILGTSRDKVNHMIID
GEERDMVPTIVENYEKLGLDALVTLGGGGTAKNAYKLAKAGLNVLHLPKTIDNDIVGTDD
SFGFSTALEIATEAIDRLHSTAHSHHRIILAEIMGHRAGWLALGSGIAGGADVILLPEVP
YKLDSIVQAVENRQKQGLNFSVIAVAEGARDEADSAAMAGAQALVDASKTSETKAAAKKA
KKDLEHSMRDNTLKLATQLEEATGLESRVSILGYVQRGGIPCAHDRLLATRLGTVGAKLV
DDGEFGIMVAAQGGDATTVPLKDVAGKVKYVPADHPWVKAARQVGTGLGD
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgtcacagtgacgcacatgattgccacaatggaccgcagtgttgtcggcgcc
atccatggaaggatgggtaccacccgacacagatcaggagtcgtcatgtccaaaaagaag
aaggtcggcatcctcaccgcaggcggtgattgccccgggctcaacgccgctatccgcgga
tttggcaaggctgccatccgccagcacgacatggagctcatcggtattcaggacggcttt
cttggattggcagggaaccgcaccatctcccttgacccgcgtgccctctcaggcatcttg
acggtcggcgggaccatcctgggaactagccgtgacaaggtcaatcacatgattatcgac
ggcgaggaacgggatatggtccccaccatcgtcgagaattacgagaagctgggacttgac
gctttggtgactttgggtggcggtggcaccgccaagaacgcgtacaagctcgctaaggcc
gggctgaacgtcctgcatctgcccaagacgattgacaacgacatcgtcggaaccgacgac
tccttcgggttctcgacagcactggagattgccacggaggccatcgaccggctgcactcc
accgcccattcccaccaccgcatcatcctcgctgagatcatgggccaccgtgccggctgg
ctggccctcggctcgggcatcgctggtggcgctgacgtcatcctgctgcccgaggtgccc
tacaagctggactccatcgtccaggcggtggaaaaccggcaaaagcaggggttgaatttc
tcggtcatcgcggtggctgagggagctcgcgatgaggctgattcggccgcgatggctgga
gctcaggccctcgttgacgcttccaagacctccgagacaaaggcggctgccaagaaggcc
aagaaggaccttgagcattccatgcgtgacaacaccctcaaattggctactcagcttgag
gaggccaccgggctggaatcgcgagtctcgatcctcggctatgtgcagcgcggtggtatc
ccgtgcgcccacgaccgtctgctcgcgaccaggctgggaaccgtgggtgccaagctcgtt
gacgacggcgagttcggcatcatggtcgccgctcagggcggagacgccacgaccgttccg
ttgaaagacgtcgctggcaaggttaaatacgtacctgccgaccacccatgggttaaggcg
gcccgacaggtcggaaccggtctaggcgactga

DBGET integrated database retrieval system