KEGG   Propionibacterium acnes C1: PAC1_01110Help
Entry
PAC1_01110        CDS       T02330                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pacc  Propionibacterium acnes C1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pacc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
263231..263836
Genome map
AA seq 201 aa AA seqDB search
MYDGPLQELIDALSRLPGIGPKGAQRIAFHILDAPAEEANELADALREVKEKAKFCKICF
NVSSDEVCQYCRDPRRDQSMICVVEESKDVIAVERTRQFRGLYHVLGGAISPLDGKGPAD
LHIRELCQRLADETVTEVILATNPNLEGEATATYLSRLIAPMGVTVSRLASGLPVGGDLE
YADEVTLGRAFEGRLHVGVGA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacggtccgctgcaagaactcattgacgccctttctcggctaccggggatcggg
ccgaagggtgcgcagcggatcgcttttcatatcctcgacgctcctgcggaggaggccaat
gaactggccgacgccttgcgcgaggtcaaagagaaggccaagttctgcaagatttgtttt
aatgtctcctccgacgaggtgtgccagtactgccgtgatccgcgtcgggaccagtcgatg
atctgtgttgttgaggagtccaaagacgttattgctgtggagcgtacccgacaattccgt
ggtctgtatcacgttcttggcggagcgatctcgccgttagacggaaaaggcccagctgat
ctccacatccgtgaattgtgccagcggttggctgacgaaaccgttaccgaggtgatcctg
gccaccaacccgaaccttgagggggaagcaacggcaacgtatctttcccgcctcatcgcg
cccatgggcgtgacggtgtcccgactagcctctggtttgccggttggcggcgacctggaa
tacgccgacgaggtcaccctggggcgcgccttcgagggacgcctccatgtgggagttggt
gcttga

DBGET integrated database retrieval system