KEGG   Propionibacterium acnes C1: PAC1_01435Help
Entry
PAC1_01435        CDS       T02330                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pacc  Propionibacterium acnes C1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PAC1_01435
Enzymes [BR:pacc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PAC1_01435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
329807..330364
Genome map
AA seq 185 aa AA seqDB search
MKTVFSLGSNMGDPFAHLRDAVRLIAETPGIHDVVVSPVYVTAPIGGVEQDDFLNLIVVA
TSDLPPSVLLERAHVIEAAHGRDHTIPNGPRTLDVDLIRVGDETVTTDELTLPHPRAHKR
AFVLVPWRDADPEAELPGYGRIADLVASFDADELADAVKPYSRQIDVAGVTVAGEWDERH
DEEDV
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaccgtattcagcctgggttccaatatgggagacccttttgcccatctgcgagac
gccgtccgcctgatcgccgaaactcccggtattcacgacgtcgtcgtttcgcccgtctat
gtcaccgctccgatcgggggagtggagcaggatgacttcctcaacctcatcgtcgttgcg
actagcgaccttcctccgtcagtcctgttggagcgcgcccatgtcatcgaggcagcccac
gggcgcgatcacaccatcccgaatggtcctcgcaccctcgacgttgatctcattcgcgtt
ggcgacgagaccgtcaccaccgacgagttgacccttccacacccccgtgcacataagcgc
gccttcgttctggtgccgtggcgcgacgccgaccctgaggctgaattgcccgggtacggt
cggatcgccgatctggtcgcctccttcgatgctgacgagctggctgacgccgttaagcct
tattcgcgtcagattgacgtagctggggtcaccgttgcaggagaatgggacgagaggcac
gacgaggaggatgtatga

DBGET integrated database retrieval system