KEGG   Propionibacterium acnes C1: PAC1_01580Help
Entry
PAC1_01580        CDS       T02330                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pacc  Propionibacterium acnes C1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAC1_01580
Enzymes [BR:pacc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PAC1_01580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(357621..359051)
Genome map
AA seq 476 aa AA seqDB search
MNISDPQHVDAVVIGGGMAGLVAAWQFTQEGLHPVLVESRGYTGGLIARSTLAGISYDIG
AEGWAVRLPDTAELATELGLTVEKPTIAPSWVYFDDACFAMPDNAILGIPANLSDPAVII
ALGAEEAARAAELDRAPMPEDLPRDLGTLVASRMGSEVLRRLVTPIAGGIHAADPHLLSV
DVVSPGLRAAAQATGSLAAGVALCRSRMPAGPAVASVAGGMFIMPAELRRQAEQAGATTM
TRVGARGLTRHGDQWLVETAGTSRNPDPSLPPVTDGEIRSFLTPRVVVACSAGPATKLLS
NVIDTVGPELAPGAPIGHVNLALQAPALDSSPRGNGMLVAPGTTTVTAKALTHMSAKWPS
LRESCPEGLHLLRVSYGRSGEANVALSVDQALTDASVLLGVDLSAEQVVDSQIIHWTGSL
APTTPQARAWRDGLHRQLEVLNQSGQGRIGLVGSWASGSGIAALVPQARRTVRQLV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaacatttctgatccgcagcacgtcgacgccgtcgtcattggcgggggcatggctggc
ctcgtggccgcctggcagttcacccaggaaggtctgcacccggtacttgtcgaatcccgc
gggtacaccggcgggctgattgccaggtcgacgctggccggaatcagctacgacatcggg
gccgaggggtgggcggtccgtctaccagacaccgctgaactggccaccgagttgggattg
acggttgagaagccgaccatcgccccgtcttgggtgtacttcgatgacgcctgcttcgcg
atgcccgataatgccattcttggcatcccggcgaacttgtcggacccagccgtcatcatc
gccctgggagcggaagaggctgcccgcgccgccgaacttgatcgcgcacccatgcctgag
gatctccctcgcgacctgggtacgctcgttgcctcccggatggggtcagaggtattgcgg
cgtctcgtcaccccgatcgccgggggaatccacgccgccgacccacatctactgtcagtc
gacgtcgtctcccccggtctgagggccgccgcccaggccaccggatcgctagcagcggga
gttgcgctgtgccgctcacggatgccagcggggcctgcagtcgcgtcggtagccggtggc
atgttcatcatgccggccgaactgcgtcgtcaggcagaacaggccggcgcgacgaccatg
acccgagtaggagctcgcgggctaacccgccacggagatcagtggctagtggagaccgct
ggtacctcccgcaatccggatccatctttgccccccgtcaccgacggcgagattcgttcc
ttcctgacccctcgggtcgtcgtggcctgttcagctggacctgccacaaaactgctcagc
aatgtcatcgacaccgttgggcccgagttggcaccgggcgcgccgatcggccacgtcaat
ctcgccttgcaggcacccgcgctggactcgagcccacgcggaaacggcatgctggtggcc
cccggaacgaccaccgttactgccaaggcacttactcacatgtcggcgaagtggcccagc
ttgagagaatcgtgtcccgaaggtctccacttgctacgggtttcctatggtcgatctggt
gaagcgaatgtcgctttgagcgtcgatcaggctctaacggacgcttccgtcctactcggc
gtggacctctcggcggagcaggtcgtagactcccagatcattcactggacaggttccctc
gcaccgacgactccacaggcccgagcatggcgcgatggtctgcaccgccagctagaggta
ttgaaccagtctggacagggacggatcggcttagtggggtcgtgggcatcgggttcgggc
attgccgctctggtgccgcaggcccgccgaactgtccgtcaacttgtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system