KEGG   Propionibacterium acnes C1: PAC1_01665Help
Entry
PAC1_01665        CDS       T02330                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
pacc  Propionibacterium acnes C1
Pathway
pacc00860  Porphyrin and chlorophyll metabolism
pacc01100  Metabolic pathways
pacc01110  Biosynthesis of secondary metabolites
pacc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAC1_01665
Enzymes [BR:pacc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     PAC1_01665
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PAC1_01665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: AFU40111
Position
374775..376490
Genome map
AA seq 571 aa AA seqDB search
MTDEAHQPTPQPAGDLGTASSQARVQFVGTGPGDPNLLTLGAVDAINRAQAIVISCAEHR
MLLGSDFLGLRPDVRIVLAGGVDEEAAVLPSQPGTGAPTPVDVDEHCADVTATVIDAASQ
GLEVVRLVSGDPFLDGDIGAEAAAVARADYDVDVVPGVTGMTAVPEYAGLTLHGHDVQLI
GDAACQRDIAGHGSNWSDQGLVVVNTEAGKLKEVVKHAIESGRGEDEPAALICHGATTQQ
TTHTVTLGELPQTAKTARLGDAEPVHVAIGKVVEAPEREQLDWYESKPLFGWNILIPRTR
DHSATLPSRLQSYGAHSLDVPTISMEPPRTPQQMDKAIRGLVEGRYEWVVFTSANAVRAV
SEKLEQIGLDARAYSGLRIAAIFDSTINALAEWGVRPDFVPSGEQSTRALAAVFPAFDEA
LDPINRVFVPRADIATESLSADLSELGWEVEDVVGYRTVRAAPPPAETREAIKTGKFDAV
VFTSSTTVRNLVGIAGKPHKHTVVAAVGMRTAETCREHGLTVDVIAPEPTALSLADALAD
FAAKRRDDMVAKGLPVVRPSQRKRRGRHPSR
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgaggctcaccagccgacgccgcagccggccggtgatctgggcactgcgtcg
tctcaggccagggtgcagtttgtgggtaccggtccaggagatccgaatctgttgaccctt
ggagctgttgacgccatcaatcgcgctcaggccatcgtcatttcgtgcgctgagcaccgc
atgctgctgggcagtgattttcttggacttcgccccgacgtcagaatcgtgttggcgggt
ggtgttgatgaagaagccgccgtcctacccagtcagccagggactggcgctccgactccc
gtcgacgtggacgaacactgcgctgacgttactgccaccgttattgatgccgcctcccaa
ggccttgaagtcgttcgtctcgtttctggggatcctttccttgatggcgatattggcgcg
gaggctgccgctgtggctcgcgctgattatgacgtcgacgttgttcccggtgtcactggc
atgaccgctgtcccggagtacgccggactgaccttgcatggccatgacgtccagctcatc
ggggacgctgcatgtcagcgcgatattgctggacatggttcgaactggtcagatcagggg
cttgtcgtcgtcaataccgaggcaggcaagcttaaagaagtcgtcaaacacgcgattgaa
tctggacgcggtgaggatgagcccgcggcccttatctgccatggcgcgacgacccagcag
accactcataccgtcaccctcggtgagttaccacagaccgctaagacagcgcgcctgggt
gacgctgagccggttcacgtcgccatcggcaaagttgtcgaagcccccgaacgtgagcag
ctcgattggtacgagtccaagccgttatttggctggaacattctcatcccgcgcacccgt
gaccactccgcgaccctgccctcgcgactacagagttacggtgctcattcccttgatgtt
cccacgatttcgatggagcctccgcgtactcctcagcagatggataaagctattcgcggt
cttgttgagggacgttacgagtgggtcgtctttacttctgccaacgcggtacgtgccgtt
tcggagaagctagagcagatcggtctggacgctcgcgcgtactcaggcttgcggattgcc
gcgatcttcgactcgactatcaacgctttggctgaatggggtgttcgacccgatttcgtg
ccatcgggcgagcagtccacccgagctctggccgcggtattcccggcctttgacgaggcc
ctcgaccccattaaccgcgttttcgtgccgcgtgccgacatcgccactgagtccctgtcg
gccgacctatctgaactgggatgggaggtcgaagacgtcgtcgggtatcgcaccgtgcga
gctgccccgccgccagctgagacccgtgaagccattaagaccggcaaattcgacgccgtc
gtgtttacctcctcgacgactgtgcgcaacctcgtcggtattgccggaaaaccacataag
cacaccgtggtcgccgccgttggtatgcgcaccgctgaaacctgccgtgagcacggcctg
accgtcgatgtcatagcccccgagccgactgcgttgagcttggctgacgccttggcggat
ttcgctgcgaagcgccgtgacgacatggttgccaagggcctgccggtagttcggccctcc
cagcgcaagcgtcgtggccgtcatccgtcacgctga

DBGET integrated database retrieval system