KEGG   Propionibacterium acnes C1: PAC1_01665Help
Entry
PAC1_01665        CDS       T02330                                 

Definition
uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
pacc  Propionibacterium acnes C1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pacc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
374775..376490
Genome map
AA seq 571 aa AA seqDB search
MTDEAHQPTPQPAGDLGTASSQARVQFVGTGPGDPNLLTLGAVDAINRAQAIVISCAEHR
MLLGSDFLGLRPDVRIVLAGGVDEEAAVLPSQPGTGAPTPVDVDEHCADVTATVIDAASQ
GLEVVRLVSGDPFLDGDIGAEAAAVARADYDVDVVPGVTGMTAVPEYAGLTLHGHDVQLI
GDAACQRDIAGHGSNWSDQGLVVVNTEAGKLKEVVKHAIESGRGEDEPAALICHGATTQQ
TTHTVTLGELPQTAKTARLGDAEPVHVAIGKVVEAPEREQLDWYESKPLFGWNILIPRTR
DHSATLPSRLQSYGAHSLDVPTISMEPPRTPQQMDKAIRGLVEGRYEWVVFTSANAVRAV
SEKLEQIGLDARAYSGLRIAAIFDSTINALAEWGVRPDFVPSGEQSTRALAAVFPAFDEA
LDPINRVFVPRADIATESLSADLSELGWEVEDVVGYRTVRAAPPPAETREAIKTGKFDAV
VFTSSTTVRNLVGIAGKPHKHTVVAAVGMRTAETCREHGLTVDVIAPEPTALSLADALAD
FAAKRRDDMVAKGLPVVRPSQRKRRGRHPSR
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgaggctcaccagccgacgccgcagccggccggtgatctgggcactgcgtcg
tctcaggccagggtgcagtttgtgggtaccggtccaggagatccgaatctgttgaccctt
ggagctgttgacgccatcaatcgcgctcaggccatcgtcatttcgtgcgctgagcaccgc
atgctgctgggcagtgattttcttggacttcgccccgacgtcagaatcgtgttggcgggt
ggtgttgatgaagaagccgccgtcctacccagtcagccagggactggcgctccgactccc
gtcgacgtggacgaacactgcgctgacgttactgccaccgttattgatgccgcctcccaa
ggccttgaagtcgttcgtctcgtttctggggatcctttccttgatggcgatattggcgcg
gaggctgccgctgtggctcgcgctgattatgacgtcgacgttgttcccggtgtcactggc
atgaccgctgtcccggagtacgccggactgaccttgcatggccatgacgtccagctcatc
ggggacgctgcatgtcagcgcgatattgctggacatggttcgaactggtcagatcagggg
cttgtcgtcgtcaataccgaggcaggcaagcttaaagaagtcgtcaaacacgcgattgaa
tctggacgcggtgaggatgagcccgcggcccttatctgccatggcgcgacgacccagcag
accactcataccgtcaccctcggtgagttaccacagaccgctaagacagcgcgcctgggt
gacgctgagccggttcacgtcgccatcggcaaagttgtcgaagcccccgaacgtgagcag
ctcgattggtacgagtccaagccgttatttggctggaacattctcatcccgcgcacccgt
gaccactccgcgaccctgccctcgcgactacagagttacggtgctcattcccttgatgtt
cccacgatttcgatggagcctccgcgtactcctcagcagatggataaagctattcgcggt
cttgttgagggacgttacgagtgggtcgtctttacttctgccaacgcggtacgtgccgtt
tcggagaagctagagcagatcggtctggacgctcgcgcgtactcaggcttgcggattgcc
gcgatcttcgactcgactatcaacgctttggctgaatggggtgttcgacccgatttcgtg
ccatcgggcgagcagtccacccgagctctggccgcggtattcccggcctttgacgaggcc
ctcgaccccattaaccgcgttttcgtgccgcgtgccgacatcgccactgagtccctgtcg
gccgacctatctgaactgggatgggaggtcgaagacgtcgtcgggtatcgcaccgtgcga
gctgccccgccgccagctgagacccgtgaagccattaagaccggcaaattcgacgccgtc
gtgtttacctcctcgacgactgtgcgcaacctcgtcggtattgccggaaaaccacataag
cacaccgtggtcgccgccgttggtatgcgcaccgctgaaacctgccgtgagcacggcctg
accgtcgatgtcatagcccccgagccgactgcgttgagcttggctgacgccttggcggat
ttcgctgcgaagcgccgtgacgacatggttgccaagggcctgccggtagttcggccctcc
cagcgcaagcgtcgtggccgtcatccgtcacgctga

DBGET integrated database retrieval system