KEGG   Propionibacterium acnes C1: PAC1_02510Help
Entry
PAC1_02510        CDS       T02330                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pacc  Propionibacterium acnes C1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PAC1_02510
   00052 Galactose metabolism
    PAC1_02510
   00500 Starch and sucrose metabolism
    PAC1_02510
   00520 Amino sugar and nucleotide sugar metabolism
    PAC1_02510
Enzymes [BR:pacc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PAC1_02510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
538874..540271
Genome map
AA seq 465 aa AA seqDB search
MSEEGLAAARQKMTEAGVDPVAIEVFTSYYHQLETGDTGLIREDTISPLTNPPMLDDVEV
SEEQAAEALDKTVIIKLNGGLGTSMGLDRAKSLLEVRDGKSFLDIIATQVLSARKTFGAR
LPLMFMNSFNTREDTLKALEKCPELAVDGLELDFLQDQEPKLDAETLAPVEWPKDSSLEW
CPPGHGDLYTALLGSGVLDHLLEAGYQYASVSNGDNLGAVPDGRLAGWFAASGAPYAAEL
CRRTINDKKGGHLAIRKSDDQLILRDTAQTAEEEMDYFTDEHRHPFFHTNNLWFDLEALK
KVLDERHGVMGLQIIRNEKTVDPKDSSSTPVIQIESAMGGAIEVFEGATCICVHRSRFLP
VKTTNELLLLRSDVYDLDDSDHLVKTTDMTCAVDLDKDFYKKIGDFDDRIPEPPSLRRAT
SLKVKGDWTFGSEVVVAGDVSLDTEKPQTIPDGTVLTGEVLGAKK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaaggacttgcggctgcacgccagaagatgaccgaggcaggtgtcgatcct
gtcgccatcgaggtcttcacttcctactaccaccagctcgagaccggcgataccggactc
atccgcgaggacaccatctcaccgctcacgaatccgccaatgctcgacgacgttgaggtc
agcgaggagcaggctgctgaggccctcgacaagaccgtcatcatcaagctcaatggcggg
ctcggaacctcgatgggcctcgaccgagctaagtcgctgctcgaggttcgtgacggcaag
tccttcctcgacatcatcgctacccaggtgctctcggctcgcaagactttcggcgctcga
ttgccgctgatgttcatgaattccttcaatacccgcgaggacaccctcaaggccctcgag
aaatgtccagagttggctgtcgacggcctagagctcgacttcctgcaggatcaggagcct
aagctcgacgctgagaccctcgccccggttgagtggccgaaggactcctccctcgagtgg
tgtcctccgggtcacggcgacctctacaccgctctgcttggatccggcgtcctcgaccat
ctgctcgaggctggataccaatacgcctcggtatccaacggtgacaatcttggtgccgtt
ccggacggtcgtctcgccggctggtttgcggcgtcgggtgctccctacgctgccgagttg
tgccgccgcactattaacgacaagaagggtggccacctggccattcgtaagtctgatgat
cagctcatcctgcgcgatacggcacagacagcagaagaggaaatggattacttcaccgac
gagcatcgtcaccccttcttccacaccaacaatctgtggtttgaccttgaagccctcaag
aaggtgctggacgagcgacacggcgtgatgggcctgcaaattattcgcaacgagaagacg
gtcgacccgaaggattcctcgtcgactcctgtcatccagattgagtccgctatggggggc
gctatcgaggtctttgaaggcgctacctgtatctgtgttcatcggtcccggttcttgccg
gtcaaaacgaccaacgagctgctgctgcttcggtctgatgtttatgacctcgacgattcg
gaccacctcgtcaagaccaccgacatgacctgcgcagtcgatcttgacaaggatttttat
aaaaagattggtgatttcgacgatcgcatccctgaaccgccatcgctgcgccgcgccacc
tcgctgaaggtcaaaggagactggacctttggttcggaggttgtcgttgcgggggatgtt
tcgctggatactgagaagcctcagacgattccggacgggaccgtgctcactggcgaagtc
cttggcgcgaaaaagtga

DBGET integrated database retrieval system