KEGG   Propionibacterium acnes C1: PAC1_03175Help
Entry
PAC1_03175        CDS       T02330                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
pacc  Propionibacterium acnes C1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PAC1_03175
Enzymes [BR:pacc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     PAC1_03175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
672385..673350
Genome map
AA seq 321 aa AA seqDB search
MVLVARDLMNGNLRLADMGFKEEAGGYDAIAAGFQGKRQWTDGKLNGDVMETLLNTSFDS
DGLRQPQVFATEGDALNGIAMLLGSLLTQRPQFFSDVRTYWSPEAVRRVTGHELTGRAAG
GFVDFRNSGASTLNATECEAEADGTPVIKHWWDLTEDDIQADLAATTFHSATQEYFPGGG
FSTHFTTVGDTTVTAVRMNMVAGVGPTLQIVEGRTLPDEGTDTIVERADPTWPTTFFVSR
IPSSGAFSSVYDWMDKWGANHTSTGYSHIGADVLTLAAMLRIPVSMHNIETKDIFRPRTW
SSSEPSSNRRARDTDRRVRPS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggtgctggttgcccgagacctcatgaacggcaatttgcgtctggccgacatgggattc
aaggaagaggccggtggttacgacgccatcgccgccggcttccagggcaagcgtcagtgg
actgatggcaagctgaacggcgacgtcatggaaaccctgctcaacaccagcttcgactcg
gatggactgcgtcagccccaggtctttgccaccgagggagatgccctcaacgggatagcg
atgctgctcggcagcctcctcactcagcgtcctcagttctttagcgatgtccgtacctat
tggagcccggaggccgttcgccgcgtcaccggtcatgagctgaccggtcgtgccgctggt
ggtttcgtcgatttcaggaattccggcgcgagcactctcaacgcgacagaatgcgaggcc
gaggcggacggcactcccgtcatcaagcactggtgggatctcaccgaggacgacatccag
gccgatctcgctgcgacgaccttccactcggcgacccaggagtacttcccgggcggcgga
ttctcgacccacttcacgacggtgggggacacgacggtgacagcggttcgtatgaacatg
gtcgctggagttggaccgaccctgcagattgtcgagggacggacgctcccggacgagggg
acagacaccatcgttgagcgggcggacccgacgtggccgacaacgttcttcgtgtcgcgc
attccctcgagcggagccttcagtagcgtttatgactggatggataagtggggagctaac
cacacctcgacggggtacagccatatcggcgctgacgttctcaccctggcagccatgctg
cgcatcccggtctcgatgcacaacattgagaccaaggacatcttccgtccgcgtacctgg
tcctcgtcggaaccgtcgtcgaaccgccgtgcgagggataccgaccgacgagtgaggccc
tcatga

DBGET integrated database retrieval system