KEGG   Propionibacterium acnes C1: PAC1_03310Help
Entry
PAC1_03310        CDS       T02330                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pacc  Propionibacterium acnes C1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAC1_03310
  Amino acid metabolism
   00300 Lysine biosynthesis
    PAC1_03310
Enzymes [BR:pacc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PAC1_03310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
701312..702391
Genome map
AA seq 359 aa AA seqDB search
MDLKPTGDLHELFRRLVDIESVSMHEAPIADAVEETLAPHRHLEVTRLGNSVVARTHLGR
SERVVIAGHLDTVPVVENLPSYIEQRSDGDYLVGRGTCDMKGGIAVALALAVSLENPVRD
VTWAFYECEEIAAEHNGLEKIASWRPDLIDGDFAILMEPTDGRVEGGCQGTMRFTLEVPG
RAAHSARSWVGHNAIHDLSAVLERLNRWQERDPFVEVDGLTFREGLNATMLDAGVAGNVI
PPTATIQINYRFAPDKTTEQARQYMEDLFHGWPMNVLDLSAPARPGLDRPLAKSFVAAVG
GEPGPKYGWTDVARFGQLGIPAVNFGPGNALCAHQVDECCRLGSLDECYRALHTWLASR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggacttgaagccgacgggcgacctgcacgagctctttcgtcgactcgtcgacatcgag
tcggtgtccatgcacgaggcgcctattgccgatgctgtggaggagacgttggcaccacat
cggcatcttgaggtgacgagactcggtaactctgtcgttgcccgtactcaccttgggcgt
tcggaacgggtcgtcattgctggtcacctcgacaccgttccggtcgtcgagaacttgccg
tcctatattgagcagcggtcggacggggattacctcgtgggtaggggcacgtgcgacatg
aagggcggtatcgccgtcgcgctcgccttggctgtgagccttgagaatccggtgagggat
gtcacttgggcgttctatgagtgtgaggagatcgcggccgagcacaacggtctggagaag
attgcctcttggcgccctgacctcatcgacggtgacttcgccatcctcatggaacccacc
gatggccgggtggagggtggttgtcagggaaccatgcgtttcacccttgaggtgccgggg
cgggcggcccattcagctcgttcgtgggtcgggcacaatgcgatccatgatctgtccgcc
gttttggagcgtctcaaccgctggcaagaacgggacccgtttgttgaggttgacgggctg
accttccgtgagggcctcaatgcgacgatgctcgacgccggtgtggccggtaacgttatt
ccccccaccgctactattcagattaattatcggttcgcccccgacaagacgaccgaacag
gctcggcagtacatggaggatctcttccatgggtggccgatgaacgttcttgacctgtcg
gctcccgccagaccagggctcgatcgtccgttggcgaagtctttcgttgctgcggtgggc
ggggaaccgggtcctaagtacgggtggaccgacgttgcccgtttcgggcaactcggaata
ccggctgttaacttcgggccggggaatgcgctgtgcgctcatcaggtggatgagtgttgt
cgtcttggctcactggatgagtgctaccgggcgctgcacacgtggttagcgtcgcgatga

DBGET integrated database retrieval system