KEGG   Propionibacterium acnes C1: PAC1_03600Help
Entry
PAC1_03600        CDS       T02330                                 

Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pacc  Propionibacterium acnes C1
Pathway
pacc00020  Citrate cycle (TCA cycle)
pacc00310  Lysine degradation
pacc01100  Metabolic pathways
pacc01110  Biosynthesis of secondary metabolites
pacc01120  Microbial metabolism in diverse environments
pacc01130  Biosynthesis of antibiotics
pacc01200  Carbon metabolism
Module
pacc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pacc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAC1_03600
  Amino acid metabolism
   00310 Lysine degradation
    PAC1_03600
Enzymes [BR:pacc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PAC1_03600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AFU40484
Position
complement(764732..766465)
Genome map
AA seq 577 aa AA seqDB search
MSTEVTLPALGESVTEGTVSRWLKAVGDTVEADEPLLEVSTDKVDTEVPSPASGTLLEIK
VPEDEDAEVGAVLAIIGDPSESGSAPAEAPSGNNEAAEPQPEPEPAAERKPAPSGGSAQG
VEVTLPALGESVTEGTVSRWLKAVGDTVEADEPLLEVSTDKVDTEVPSPASGTLLEIKVP
EDEDAEVGAVLAIIGDPSAVESAPAPAKPTAEPAEKAKPEPVKSEAEEAPAPTAPKPAEA
PKPAGTNEVAPRATNPSSDVYVTPLVRKLARENNVDLSTITGTGVGGRIRKQDVLAAAGK
SGEAPSAPQAPAAAPAPAAPKPAGSARKASQEVSPEAAALRGTTEKMSRLRKVIASRMVE
SLQISAQLTATVEVDMTAISRIRNAEKAAFKAREGVGLSYLPFITKAVVEALKANPTFNA
NIDTEAGTITYGSSENIGIAVDTPRGLLVPVIKNAGDLNIAGLAHQIGDLAARTRDNKVT
PDELSGGTFTITNYGSAGALFDTPIVNQPEVAILGTGALVKRPVVVTNEFGEDTIAVRDM
MYLSLSYDHRLIDGAVAARFLSGIKARLEEGDFAGEF
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgaagtcactcttcctgcactgggcgagtccgtcaccgaaggcaccgtgtcc
cgctggctcaaggctgtcggagacaccgtcgaggccgacgaacccttacttgaggtgtcc
accgacaaggtcgataccgaagtcccctcccccgcctccggcaccctacttgagatcaag
gtccccgaagacgaagacgccgaagtcggcgccgtcctagccatcatcggcgacccctcc
gagtcgggctctgcgcctgctgaggcccccagtggcaataatgaagctgccgaaccgcag
cccgaacctgagccggctgccgagcggaagccggctccttccggtggttccgctcaggga
gttgaggtcaccctgccggctctgggcgagtccgtcaccgaaggcaccgtgtcccgctgg
ctcaaggctgtcggagacaccgtcgaggccgacgaacccttacttgaggtgtccaccgac
aaggtcgataccgaagtcccctcccccgcctccggcaccctacttgagatcaaggtcccc
gaagacgaagacgccgaagtcggcgccgtcctagccatcatcggcgacccctctgctgtc
gagtcggcccctgcgcctgctaagccgacggctgagcccgcggagaaggccaaacctgag
ccggtgaagagcgaggccgaggaggcaccggcgccgaccgcgccgaagcccgccgaggct
cccaaacccgccgggaccaatgaggtcgccccacgcgccaccaacccgtcgtcggacgtc
tacgtcaccccgctagtccgcaagctcgcccgggagaacaacgtcgacctgtcgacgatc
accggaactggtgtcgggggtcgtattcgcaagcaagacgtactagctgcagccggtaag
tctggagaagctccctcagctcctcaggcaccggctgccgcccctgccccggctgctccg
aaaccggctggttcagcccgtaaagcctcccaggaagtctctccggaagctgccgctctg
cgcggcaccaccgagaagatgagccgtctacgcaaggtcatcgcctcgcggatggttgag
tccctgcagatctcggctcagttgacggccaccgtcgaggtggacatgaccgctatctcc
cgcatccgcaacgctgagaaggctgctttcaaggcccgcgagggagtcggtctgtcctac
ttgcctttcattaccaaggccgtcgttgaagccctcaaggccaatccgaccttcaacgca
aatatcgacaccgaggcggggacgattacctacggttcttctgagaacatcggcatcgcc
gttgataccccgcgcgggctgctggttccggtcatcaagaacgctggtgatctcaatatc
gctgggctggcccaccagattggcgatctcgctgcccgcacccgcgacaacaaggtgacc
cctgacgagctgtccggcggcaccttcaccatcaccaactatggctcggctggagccctc
ttcgacaccccgatcgtcaaccagcccgaggtcgccatcctcggcaccggtgctctggtt
aagcgcccagtcgtcgtcaccaacgagttcggcgaggataccatcgcagtccgcgacatg
atgtacctctcgctgtcctacgatcaccggctcattgacggcgctgtggcggctcgcttc
ctatcgggcatcaaggctcgtctggaggagggcgacttcgccggagagttctga

DBGET integrated database retrieval system